| Basic Information | |
|---|---|
| Family ID | F008422 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 333 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MNYQKGDVFLDKDTHKLYIFDGNEWWEIVPTSKLKKPDWT |
| Number of Associated Samples | 175 |
| Number of Associated Scaffolds | 333 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 22.29 % |
| % of genes near scaffold ends (potentially truncated) | 14.11 % |
| % of genes from short scaffolds (< 2000 bps) | 69.67 % |
| Associated GOLD sequencing projects | 159 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.68 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (46.246 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (25.526 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.036 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (62.763 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.06% Coil/Unstructured: 77.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 333 Family Scaffolds |
|---|---|---|
| PF00004 | AAA | 40.84 |
| PF02675 | AdoMet_dc | 9.91 |
| PF02086 | MethyltransfD12 | 3.90 |
| PF08406 | CbbQ_C | 3.60 |
| PF11753 | DUF3310 | 2.70 |
| PF09116 | gp45-slide_C | 1.50 |
| PF03215 | Rad17 | 1.50 |
| PF01541 | GIY-YIG | 1.20 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.20 |
| PF01818 | Translat_reg | 0.90 |
| PF14236 | DUF4338 | 0.90 |
| PF16790 | Phage_clamp_A | 0.90 |
| PF00011 | HSP20 | 0.90 |
| PF13392 | HNH_3 | 0.60 |
| PF09492 | Pec_lyase | 0.30 |
| PF08722 | Tn7_TnsA-like_N | 0.30 |
| PF01370 | Epimerase | 0.30 |
| PF02902 | Peptidase_C48 | 0.30 |
| PF05996 | Fe_bilin_red | 0.30 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.30 |
| PF03477 | ATP-cone | 0.30 |
| PF07068 | Gp23 | 0.30 |
| PF00124 | Photo_RC | 0.30 |
| PF11056 | UvsY | 0.30 |
| PF03567 | Sulfotransfer_2 | 0.30 |
| PF02463 | SMC_N | 0.30 |
| PF00271 | Helicase_C | 0.30 |
| PF02945 | Endonuclease_7 | 0.30 |
| PF07728 | AAA_5 | 0.30 |
| PF04851 | ResIII | 0.30 |
| COG ID | Name | Functional Category | % Frequency in 333 Family Scaffolds |
|---|---|---|---|
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 9.91 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 3.90 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 3.90 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 3.60 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.90 |
| COG5160 | Protease, Ulp1 family | Posttranslational modification, protein turnover, chaperones [O] | 0.30 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.38 % |
| Unclassified | root | N/A | 15.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10051399 | All Organisms → Viruses → Predicted Viral | 1802 | Open in IMG/M |
| 3300001336|ML7_10222117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 576 | Open in IMG/M |
| 3300001533|MLSed_10251474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 659 | Open in IMG/M |
| 3300001818|ACM19_102014 | Not Available | 603 | Open in IMG/M |
| 3300001828|ACM3_1002436 | All Organisms → Viruses → Predicted Viral | 1242 | Open in IMG/M |
| 3300001831|ACM4_1013670 | Not Available | 560 | Open in IMG/M |
| 3300001843|RCM34_1023608 | Not Available | 994 | Open in IMG/M |
| 3300001846|ACM22_1033430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3602 | Open in IMG/M |
| 3300001968|GOS2236_1001411 | All Organisms → Viruses → Predicted Viral | 1589 | Open in IMG/M |
| 3300001968|GOS2236_1045975 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300001968|GOS2236_1056724 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
| 3300001968|GOS2236_1063461 | All Organisms → Viruses → Predicted Viral | 3522 | Open in IMG/M |
| 3300001968|GOS2236_1078514 | All Organisms → Viruses → Predicted Viral | 1807 | Open in IMG/M |
| 3300001968|GOS2236_1086550 | All Organisms → Viruses → Predicted Viral | 1834 | Open in IMG/M |
| 3300002272|B570J29579_105811 | Not Available | 606 | Open in IMG/M |
| 3300002408|B570J29032_109862334 | All Organisms → Viruses → Predicted Viral | 1741 | Open in IMG/M |
| 3300002835|B570J40625_100021924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 10692 | Open in IMG/M |
| 3300002835|B570J40625_100027118 | Not Available | 9248 | Open in IMG/M |
| 3300002835|B570J40625_100063611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5005 | Open in IMG/M |
| 3300002835|B570J40625_101224908 | Not Available | 627 | Open in IMG/M |
| 3300002835|B570J40625_101578885 | Not Available | 536 | Open in IMG/M |
| 3300002835|B570J40625_101657697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 521 | Open in IMG/M |
| 3300003430|JGI25921J50272_10028933 | All Organisms → Viruses → Predicted Viral | 1394 | Open in IMG/M |
| 3300004481|Ga0069718_16380195 | Not Available | 6517 | Open in IMG/M |
| 3300005512|Ga0074648_1000029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 157170 | Open in IMG/M |
| 3300005512|Ga0074648_1020639 | All Organisms → Viruses → Predicted Viral | 3706 | Open in IMG/M |
| 3300005527|Ga0068876_10019435 | All Organisms → Viruses → Predicted Viral | 4311 | Open in IMG/M |
| 3300005527|Ga0068876_10042424 | All Organisms → Viruses → Predicted Viral | 2799 | Open in IMG/M |
| 3300005527|Ga0068876_10053053 | All Organisms → Viruses → Predicted Viral | 2469 | Open in IMG/M |
| 3300005527|Ga0068876_10366653 | All Organisms → cellular organisms → Archaea | 807 | Open in IMG/M |
| 3300005582|Ga0049080_10012876 | All Organisms → Viruses → Predicted Viral | 2907 | Open in IMG/M |
| 3300005613|Ga0074649_1000970 | Not Available | 36070 | Open in IMG/M |
| 3300005613|Ga0074649_1012644 | All Organisms → cellular organisms → Bacteria | 5625 | Open in IMG/M |
| 3300005613|Ga0074649_1067459 | Not Available | 1439 | Open in IMG/M |
| 3300005662|Ga0078894_11085947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 684 | Open in IMG/M |
| 3300005805|Ga0079957_1019349 | All Organisms → Viruses → Predicted Viral | 4807 | Open in IMG/M |
| 3300005805|Ga0079957_1063656 | All Organisms → Viruses → Predicted Viral | 2171 | Open in IMG/M |
| 3300005805|Ga0079957_1170965 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
| 3300005805|Ga0079957_1287449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 746 | Open in IMG/M |
| 3300005934|Ga0066377_10213557 | Not Available | 594 | Open in IMG/M |
| 3300005941|Ga0070743_10007298 | All Organisms → Viruses → Predicted Viral | 3936 | Open in IMG/M |
| 3300005943|Ga0073926_10135805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 516 | Open in IMG/M |
| 3300006025|Ga0075474_10165115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 690 | Open in IMG/M |
| 3300006030|Ga0075470_10005383 | All Organisms → Viruses → Predicted Viral | 3958 | Open in IMG/M |
| 3300006030|Ga0075470_10219877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 540 | Open in IMG/M |
| 3300006562|Ga0101390_1001293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 847 | Open in IMG/M |
| 3300006639|Ga0079301_1008555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 | 3912 | Open in IMG/M |
| 3300006641|Ga0075471_10007086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 7088 | Open in IMG/M |
| 3300006641|Ga0075471_10012512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5163 | Open in IMG/M |
| 3300006641|Ga0075471_10024962 | All Organisms → Viruses → Predicted Viral | 3497 | Open in IMG/M |
| 3300006641|Ga0075471_10055606 | All Organisms → Viruses → Predicted Viral | 2191 | Open in IMG/M |
| 3300006802|Ga0070749_10045003 | All Organisms → Viruses → Predicted Viral | 2704 | Open in IMG/M |
| 3300006802|Ga0070749_10391122 | Not Available | 768 | Open in IMG/M |
| 3300006810|Ga0070754_10071397 | All Organisms → Viruses → Predicted Viral | 1773 | Open in IMG/M |
| 3300006810|Ga0070754_10136481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1183 | Open in IMG/M |
| 3300006810|Ga0070754_10239220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 832 | Open in IMG/M |
| 3300006867|Ga0075476_10028314 | All Organisms → Viruses → Predicted Viral | 2367 | Open in IMG/M |
| 3300006869|Ga0075477_10181058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 870 | Open in IMG/M |
| 3300006869|Ga0075477_10372685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 558 | Open in IMG/M |
| 3300006916|Ga0070750_10345287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 629 | Open in IMG/M |
| 3300006917|Ga0075472_10021798 | All Organisms → Viruses → Predicted Viral | 2918 | Open in IMG/M |
| 3300006917|Ga0075472_10422577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 660 | Open in IMG/M |
| 3300007344|Ga0070745_1217514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 700 | Open in IMG/M |
| 3300007345|Ga0070752_1175042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 869 | Open in IMG/M |
| 3300007538|Ga0099851_1158283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 840 | Open in IMG/M |
| 3300007538|Ga0099851_1284786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 585 | Open in IMG/M |
| 3300007538|Ga0099851_1285787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 584 | Open in IMG/M |
| 3300007538|Ga0099851_1294211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 574 | Open in IMG/M |
| 3300007539|Ga0099849_1003780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 6995 | Open in IMG/M |
| 3300007539|Ga0099849_1153215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 890 | Open in IMG/M |
| 3300007539|Ga0099849_1157450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 875 | Open in IMG/M |
| 3300007539|Ga0099849_1219509 | All Organisms → Viruses | 709 | Open in IMG/M |
| 3300007539|Ga0099849_1236931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 675 | Open in IMG/M |
| 3300007539|Ga0099849_1306275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 572 | Open in IMG/M |
| 3300007539|Ga0099849_1329524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 546 | Open in IMG/M |
| 3300007539|Ga0099849_1342076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 533 | Open in IMG/M |
| 3300007540|Ga0099847_1190274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 601 | Open in IMG/M |
| 3300007540|Ga0099847_1225487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 543 | Open in IMG/M |
| 3300007541|Ga0099848_1043512 | All Organisms → Viruses → Predicted Viral | 1830 | Open in IMG/M |
| 3300007541|Ga0099848_1129945 | Not Available | 946 | Open in IMG/M |
| 3300007541|Ga0099848_1166407 | Not Available | 808 | Open in IMG/M |
| 3300007541|Ga0099848_1272986 | Not Available | 586 | Open in IMG/M |
| 3300007541|Ga0099848_1281133 | Not Available | 575 | Open in IMG/M |
| 3300007542|Ga0099846_1020898 | All Organisms → Viruses → Predicted Viral | 2544 | Open in IMG/M |
| 3300007542|Ga0099846_1154136 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 825 | Open in IMG/M |
| 3300007542|Ga0099846_1321833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 527 | Open in IMG/M |
| 3300007542|Ga0099846_1336743 | Not Available | 513 | Open in IMG/M |
| 3300007640|Ga0070751_1298325 | Not Available | 601 | Open in IMG/M |
| 3300007735|Ga0104988_10757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 26533 | Open in IMG/M |
| 3300007960|Ga0099850_1026300 | All Organisms → Viruses → Predicted Viral | 2560 | Open in IMG/M |
| 3300007960|Ga0099850_1202451 | Not Available | 781 | Open in IMG/M |
| 3300007960|Ga0099850_1226366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 727 | Open in IMG/M |
| 3300007960|Ga0099850_1282764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 633 | Open in IMG/M |
| 3300007960|Ga0099850_1284015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 631 | Open in IMG/M |
| 3300007960|Ga0099850_1357235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 546 | Open in IMG/M |
| 3300007972|Ga0105745_1270851 | Not Available | 549 | Open in IMG/M |
| 3300008055|Ga0108970_10414405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1006 | Open in IMG/M |
| 3300008107|Ga0114340_1002611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 10449 | Open in IMG/M |
| 3300008107|Ga0114340_1004804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 10955 | Open in IMG/M |
| 3300008113|Ga0114346_1002430 | All Organisms → Viruses | 26540 | Open in IMG/M |
| 3300008113|Ga0114346_1140158 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
| 3300008448|Ga0114876_1002413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 13157 | Open in IMG/M |
| 3300008996|Ga0102831_1028007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1914 | Open in IMG/M |
| 3300008996|Ga0102831_1174172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 713 | Open in IMG/M |
| 3300009001|Ga0102963_1093787 | All Organisms → Viruses → Predicted Viral | 1225 | Open in IMG/M |
| 3300009009|Ga0105105_10050054 | All Organisms → Viruses → Predicted Viral | 1885 | Open in IMG/M |
| 3300009027|Ga0102957_1107292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 976 | Open in IMG/M |
| 3300009059|Ga0102830_1132081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 735 | Open in IMG/M |
| 3300009124|Ga0118687_10066398 | All Organisms → Viruses → Predicted Viral | 1217 | Open in IMG/M |
| 3300009124|Ga0118687_10088381 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
| 3300009149|Ga0114918_10666252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 547 | Open in IMG/M |
| 3300009155|Ga0114968_10015009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 5454 | Open in IMG/M |
| 3300009155|Ga0114968_10526798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 632 | Open in IMG/M |
| 3300009159|Ga0114978_10009967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 7355 | Open in IMG/M |
| 3300009163|Ga0114970_10352787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 827 | Open in IMG/M |
| 3300009165|Ga0105102_10071842 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300009183|Ga0114974_10710376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 545 | Open in IMG/M |
| 3300009239|Ga0103858_10103301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 713 | Open in IMG/M |
| 3300010296|Ga0129348_1080673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1156 | Open in IMG/M |
| 3300010296|Ga0129348_1218336 | Not Available | 646 | Open in IMG/M |
| 3300010296|Ga0129348_1236994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3 | 615 | Open in IMG/M |
| 3300010296|Ga0129348_1288271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 549 | Open in IMG/M |
| 3300010297|Ga0129345_1063116 | All Organisms → Viruses → Predicted Viral | 1404 | Open in IMG/M |
| 3300010297|Ga0129345_1117067 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 979 | Open in IMG/M |
| 3300010297|Ga0129345_1342576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 515 | Open in IMG/M |
| 3300010299|Ga0129342_1289157 | Not Available | 565 | Open in IMG/M |
| 3300010299|Ga0129342_1317416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 534 | Open in IMG/M |
| 3300010299|Ga0129342_1341011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 511 | Open in IMG/M |
| 3300010300|Ga0129351_1053460 | All Organisms → Viruses → Predicted Viral | 1650 | Open in IMG/M |
| 3300010300|Ga0129351_1120290 | Not Available | 1047 | Open in IMG/M |
| 3300010300|Ga0129351_1337766 | Not Available | 566 | Open in IMG/M |
| 3300010318|Ga0136656_1053989 | All Organisms → Viruses → Predicted Viral | 1443 | Open in IMG/M |
| 3300010354|Ga0129333_10103439 | All Organisms → Viruses → Predicted Viral | 2630 | Open in IMG/M |
| 3300010354|Ga0129333_10134933 | All Organisms → Viruses → Predicted Viral | 2269 | Open in IMG/M |
| 3300010354|Ga0129333_10190567 | Not Available | 1868 | Open in IMG/M |
| 3300010354|Ga0129333_10327612 | All Organisms → Viruses → Predicted Viral | 1366 | Open in IMG/M |
| 3300010354|Ga0129333_10342989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1330 | Open in IMG/M |
| 3300010354|Ga0129333_10462271 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300010354|Ga0129333_10501353 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
| 3300010354|Ga0129333_10667461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 896 | Open in IMG/M |
| 3300010354|Ga0129333_10683478 | Not Available | 884 | Open in IMG/M |
| 3300010354|Ga0129333_10754101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 833 | Open in IMG/M |
| 3300010354|Ga0129333_11043884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 685 | Open in IMG/M |
| 3300010354|Ga0129333_11349436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 588 | Open in IMG/M |
| 3300010354|Ga0129333_11527047 | Not Available | 547 | Open in IMG/M |
| 3300010354|Ga0129333_11745543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 505 | Open in IMG/M |
| 3300010354|Ga0129333_11754280 | Not Available | 504 | Open in IMG/M |
| 3300010368|Ga0129324_10185751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 851 | Open in IMG/M |
| 3300010368|Ga0129324_10330726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 595 | Open in IMG/M |
| 3300010368|Ga0129324_10382959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 545 | Open in IMG/M |
| 3300010370|Ga0129336_10137418 | All Organisms → Viruses → Predicted Viral | 1417 | Open in IMG/M |
| 3300010370|Ga0129336_10502605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 653 | Open in IMG/M |
| 3300010389|Ga0136549_10004204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 10518 | Open in IMG/M |
| 3300010389|Ga0136549_10022556 | All Organisms → Viruses → Predicted Viral | 3728 | Open in IMG/M |
| 3300010389|Ga0136549_10182672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 923 | Open in IMG/M |
| 3300011268|Ga0151620_1007160 | All Organisms → Viruses → Predicted Viral | 4071 | Open in IMG/M |
| 3300011268|Ga0151620_1064634 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
| 3300012006|Ga0119955_1033710 | All Organisms → Viruses → Predicted Viral | 1684 | Open in IMG/M |
| 3300012520|Ga0129344_1186162 | Not Available | 1237 | Open in IMG/M |
| 3300012520|Ga0129344_1197004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 2784 | Open in IMG/M |
| 3300012520|Ga0129344_1211706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 668 | Open in IMG/M |
| 3300012520|Ga0129344_1431153 | Not Available | 646 | Open in IMG/M |
| 3300012525|Ga0129353_1082470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 600 | Open in IMG/M |
| 3300012963|Ga0129340_1134194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 817 | Open in IMG/M |
| 3300012966|Ga0129341_1001341 | Not Available | 569 | Open in IMG/M |
| 3300012966|Ga0129341_1230564 | Not Available | 598 | Open in IMG/M |
| 3300012966|Ga0129341_1259585 | Not Available | 532 | Open in IMG/M |
| 3300012967|Ga0129343_1115441 | Not Available | 916 | Open in IMG/M |
| 3300012967|Ga0129343_1210556 | All Organisms → Viruses → Predicted Viral | 3010 | Open in IMG/M |
| 3300012970|Ga0129338_1220916 | All Organisms → Viruses → Predicted Viral | 2246 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10336421 | Not Available | 701 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10446207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 639 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10224060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1163 | Open in IMG/M |
| 3300013188|Ga0116834_1124297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 555 | Open in IMG/M |
| 3300013231|Ga0116832_1091931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 514 | Open in IMG/M |
| 3300014819|Ga0119954_1000702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 11604 | Open in IMG/M |
| 3300017949|Ga0181584_10089570 | All Organisms → Viruses → Predicted Viral | 2116 | Open in IMG/M |
| 3300017949|Ga0181584_10231912 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300017951|Ga0181577_10122368 | All Organisms → Viruses → Predicted Viral | 1786 | Open in IMG/M |
| 3300017952|Ga0181583_10042819 | All Organisms → Viruses → Predicted Viral | 3227 | Open in IMG/M |
| 3300017952|Ga0181583_10148082 | All Organisms → Viruses → Predicted Viral | 1572 | Open in IMG/M |
| 3300017952|Ga0181583_10493402 | Not Available | 749 | Open in IMG/M |
| 3300017956|Ga0181580_10378748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 946 | Open in IMG/M |
| 3300017956|Ga0181580_10622130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 694 | Open in IMG/M |
| 3300017962|Ga0181581_10078697 | All Organisms → Viruses → Predicted Viral | 2295 | Open in IMG/M |
| 3300017962|Ga0181581_10372776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 902 | Open in IMG/M |
| 3300017962|Ga0181581_10781202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 570 | Open in IMG/M |
| 3300017963|Ga0180437_10061850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 3387 | Open in IMG/M |
| 3300017967|Ga0181590_10187882 | All Organisms → Viruses → Predicted Viral | 1560 | Open in IMG/M |
| 3300017967|Ga0181590_10972278 | Not Available | 555 | Open in IMG/M |
| 3300017971|Ga0180438_10287077 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300018080|Ga0180433_10065395 | All Organisms → Viruses → Predicted Viral | 3288 | Open in IMG/M |
| 3300018558|Ga0188836_100146 | All Organisms → Viruses → Predicted Viral | 2072 | Open in IMG/M |
| 3300019756|Ga0194023_1041771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 925 | Open in IMG/M |
| 3300020074|Ga0194113_10254967 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
| 3300020074|Ga0194113_10268033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1315 | Open in IMG/M |
| 3300020083|Ga0194111_10434236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 860 | Open in IMG/M |
| 3300020084|Ga0194110_10184036 | All Organisms → Viruses → Predicted Viral | 1597 | Open in IMG/M |
| 3300020161|Ga0211726_10320395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1002 | Open in IMG/M |
| 3300020189|Ga0181578_10401160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 598 | Open in IMG/M |
| 3300020498|Ga0208050_1001694 | All Organisms → Viruses → Predicted Viral | 3061 | Open in IMG/M |
| 3300020498|Ga0208050_1025746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 596 | Open in IMG/M |
| 3300020506|Ga0208091_1001844 | All Organisms → Viruses → Predicted Viral | 3276 | Open in IMG/M |
| 3300020553|Ga0208855_1003863 | All Organisms → Viruses → Predicted Viral | 2981 | Open in IMG/M |
| 3300020571|Ga0208723_1054155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 548 | Open in IMG/M |
| 3300021141|Ga0214163_1025012 | All Organisms → Viruses → Predicted Viral | 1754 | Open in IMG/M |
| 3300021356|Ga0213858_10049916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 → Synechococcus phage S-SKS1 | 2024 | Open in IMG/M |
| 3300021364|Ga0213859_10281937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 754 | Open in IMG/M |
| 3300021373|Ga0213865_10001215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → unclassified Cymopoleiavirus → Synechococcus phage S-RSM4 | 16977 | Open in IMG/M |
| 3300021373|Ga0213865_10011774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 5026 | Open in IMG/M |
| 3300021379|Ga0213864_10013195 | All Organisms → Viruses → Predicted Viral | 3704 | Open in IMG/M |
| 3300021379|Ga0213864_10061117 | All Organisms → Viruses → Predicted Viral | 1818 | Open in IMG/M |
| 3300021389|Ga0213868_10419821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 736 | Open in IMG/M |
| 3300021425|Ga0213866_10473950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 600 | Open in IMG/M |
| 3300021957|Ga0222717_10136634 | All Organisms → Viruses → Predicted Viral | 1505 | Open in IMG/M |
| 3300021958|Ga0222718_10014928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 5568 | Open in IMG/M |
| 3300021959|Ga0222716_10220334 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| 3300021959|Ga0222716_10299990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 970 | Open in IMG/M |
| 3300021959|Ga0222716_10449278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 737 | Open in IMG/M |
| 3300021959|Ga0222716_10678135 | Not Available | 550 | Open in IMG/M |
| 3300021960|Ga0222715_10001064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 26954 | Open in IMG/M |
| 3300021960|Ga0222715_10002636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → unclassified Cymopoleiavirus → Synechococcus phage S-RSM4 | 16276 | Open in IMG/M |
| 3300021960|Ga0222715_10005757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 10516 | Open in IMG/M |
| 3300021960|Ga0222715_10006339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 10006 | Open in IMG/M |
| 3300021960|Ga0222715_10008645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 8342 | Open in IMG/M |
| 3300021960|Ga0222715_10010455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 7444 | Open in IMG/M |
| 3300021960|Ga0222715_10017423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 5467 | Open in IMG/M |
| 3300021960|Ga0222715_10040618 | All Organisms → Viruses → Predicted Viral | 3276 | Open in IMG/M |
| 3300021960|Ga0222715_10127998 | All Organisms → Viruses → Predicted Viral | 1603 | Open in IMG/M |
| 3300021960|Ga0222715_10284361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 946 | Open in IMG/M |
| 3300021960|Ga0222715_10523605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 625 | Open in IMG/M |
| 3300021960|Ga0222715_10523955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 625 | Open in IMG/M |
| 3300021960|Ga0222715_10557621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 598 | Open in IMG/M |
| 3300021960|Ga0222715_10624343 | Not Available | 553 | Open in IMG/M |
| 3300021961|Ga0222714_10002911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 17790 | Open in IMG/M |
| 3300021961|Ga0222714_10004905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 12945 | Open in IMG/M |
| 3300021961|Ga0222714_10006866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 10540 | Open in IMG/M |
| 3300021961|Ga0222714_10009110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 8744 | Open in IMG/M |
| 3300021961|Ga0222714_10032872 | All Organisms → Viruses → Predicted Viral | 3824 | Open in IMG/M |
| 3300021961|Ga0222714_10052635 | All Organisms → Viruses → Predicted Viral | 2808 | Open in IMG/M |
| 3300021961|Ga0222714_10100834 | All Organisms → Viruses → Predicted Viral | 1827 | Open in IMG/M |
| 3300021961|Ga0222714_10110495 | All Organisms → Viruses → Predicted Viral | 1718 | Open in IMG/M |
| 3300021961|Ga0222714_10185565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1213 | Open in IMG/M |
| 3300021961|Ga0222714_10232314 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300021961|Ga0222714_10298890 | All Organisms → Viruses | 884 | Open in IMG/M |
| 3300021961|Ga0222714_10327723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 830 | Open in IMG/M |
| 3300021961|Ga0222714_10408618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 715 | Open in IMG/M |
| 3300021961|Ga0222714_10517417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 609 | Open in IMG/M |
| 3300021963|Ga0222712_10040212 | All Organisms → Viruses → Predicted Viral | 3584 | Open in IMG/M |
| 3300021964|Ga0222719_10112293 | All Organisms → Viruses → Predicted Viral | 1976 | Open in IMG/M |
| 3300021964|Ga0222719_10624755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 622 | Open in IMG/M |
| 3300022179|Ga0181353_1019305 | All Organisms → Viruses → Predicted Viral | 1786 | Open in IMG/M |
| 3300022187|Ga0196899_1074355 | Not Available | 1052 | Open in IMG/M |
| 3300022200|Ga0196901_1019286 | All Organisms → Viruses → Predicted Viral | 2768 | Open in IMG/M |
| 3300022213|Ga0224500_10029143 | All Organisms → Viruses → Predicted Viral | 2301 | Open in IMG/M |
| 3300022752|Ga0214917_10064507 | All Organisms → Viruses → Predicted Viral | 2353 | Open in IMG/M |
| 3300023116|Ga0255751_10023483 | All Organisms → Viruses → Predicted Viral | 4681 | Open in IMG/M |
| 3300023116|Ga0255751_10045260 | All Organisms → Viruses → Predicted Viral | 3071 | Open in IMG/M |
| 3300023116|Ga0255751_10505446 | All Organisms → Viruses | 569 | Open in IMG/M |
| 3300023116|Ga0255751_10588011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 506 | Open in IMG/M |
| 3300023179|Ga0214923_10000476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 61183 | Open in IMG/M |
| 3300024346|Ga0244775_10018026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 6494 | Open in IMG/M |
| 3300024346|Ga0244775_10187871 | All Organisms → Viruses → Predicted Viral | 1736 | Open in IMG/M |
| 3300024346|Ga0244775_10229802 | All Organisms → Viruses → Predicted Viral | 1550 | Open in IMG/M |
| 3300025075|Ga0209615_109761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 531 | Open in IMG/M |
| 3300025151|Ga0209645_1021658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2438 | Open in IMG/M |
| 3300025543|Ga0208303_1006178 | All Organisms → Viruses → Predicted Viral | 4015 | Open in IMG/M |
| 3300025585|Ga0208546_1004661 | All Organisms → Viruses → Predicted Viral | 3868 | Open in IMG/M |
| 3300025585|Ga0208546_1065630 | All Organisms → Viruses | 846 | Open in IMG/M |
| 3300025585|Ga0208546_1105094 | All Organisms → Viruses | 629 | Open in IMG/M |
| 3300025646|Ga0208161_1122478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Libanvirus → unclassified Libanvirus → Libanvirus sp. | 685 | Open in IMG/M |
| 3300025647|Ga0208160_1129028 | Not Available | 632 | Open in IMG/M |
| 3300025653|Ga0208428_1070434 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300025674|Ga0208162_1000305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 28993 | Open in IMG/M |
| 3300025674|Ga0208162_1041634 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
| 3300025674|Ga0208162_1063983 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
| 3300025674|Ga0208162_1071269 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300025674|Ga0208162_1087928 | Not Available | 948 | Open in IMG/M |
| 3300025674|Ga0208162_1121330 | Not Available | 750 | Open in IMG/M |
| 3300025674|Ga0208162_1126824 | All Organisms → Viruses | 725 | Open in IMG/M |
| 3300025687|Ga0208019_1042287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 1621 | Open in IMG/M |
| 3300025687|Ga0208019_1208649 | All Organisms → Viruses | 506 | Open in IMG/M |
| 3300025732|Ga0208784_1000511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 18659 | Open in IMG/M |
| 3300025732|Ga0208784_1021269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2113 | Open in IMG/M |
| 3300025751|Ga0208150_1200354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 616 | Open in IMG/M |
| 3300025991|Ga0210128_1091429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 515 | Open in IMG/M |
| 3300026085|Ga0208880_1046724 | Not Available | 937 | Open in IMG/M |
| 3300027499|Ga0208788_1003235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 7335 | Open in IMG/M |
| 3300027508|Ga0255072_1035923 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
| 3300027529|Ga0255077_1063234 | Not Available | 690 | Open in IMG/M |
| 3300027693|Ga0209704_1056393 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300027736|Ga0209190_1154337 | Not Available | 991 | Open in IMG/M |
| 3300027754|Ga0209596_1001263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 22121 | Open in IMG/M |
| 3300027782|Ga0209500_10000290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 45094 | Open in IMG/M |
| 3300027816|Ga0209990_10104766 | All Organisms → Viruses → Predicted Viral | 1370 | Open in IMG/M |
| 3300027888|Ga0209635_10143812 | All Organisms → Viruses → Predicted Viral | 1953 | Open in IMG/M |
| 3300027892|Ga0209550_10850753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 506 | Open in IMG/M |
| 3300027917|Ga0209536_100267442 | All Organisms → Viruses → Predicted Viral | 2141 | Open in IMG/M |
| 3300027917|Ga0209536_101834264 | Not Available | 730 | Open in IMG/M |
| 3300027917|Ga0209536_102259984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 647 | Open in IMG/M |
| 3300027917|Ga0209536_102779064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → unclassified Cymopoleiavirus → Synechococcus phage S-RSM4 | 571 | Open in IMG/M |
| 3300029930|Ga0119944_1004217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2362 | Open in IMG/M |
| 3300029930|Ga0119944_1012198 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300029930|Ga0119944_1035517 | All Organisms → Viruses | 629 | Open in IMG/M |
| 3300029933|Ga0119945_1011422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1146 | Open in IMG/M |
| 3300031539|Ga0307380_10157461 | All Organisms → Viruses → Predicted Viral | 2247 | Open in IMG/M |
| 3300031539|Ga0307380_10218357 | All Organisms → Viruses → Predicted Viral | 1827 | Open in IMG/M |
| 3300031539|Ga0307380_10534312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1024 | Open in IMG/M |
| 3300031565|Ga0307379_10282572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1647 | Open in IMG/M |
| 3300031673|Ga0307377_11070360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 536 | Open in IMG/M |
| 3300031746|Ga0315293_10398850 | All Organisms → Viruses | 1083 | Open in IMG/M |
| 3300031758|Ga0315907_10406647 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300031784|Ga0315899_10050894 | All Organisms → Viruses → Predicted Viral | 4331 | Open in IMG/M |
| 3300031784|Ga0315899_10526274 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300031857|Ga0315909_10573210 | All Organisms → Viruses | 761 | Open in IMG/M |
| 3300031951|Ga0315904_10289836 | All Organisms → Viruses → Predicted Viral | 1541 | Open in IMG/M |
| 3300031999|Ga0315274_11233124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 737 | Open in IMG/M |
| 3300032050|Ga0315906_10375757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1248 | Open in IMG/M |
| 3300032050|Ga0315906_10981241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 638 | Open in IMG/M |
| 3300033418|Ga0316625_100140794 | All Organisms → Viruses → Predicted Viral | 1466 | Open in IMG/M |
| 3300033488|Ga0316621_10786779 | All Organisms → Viruses | 695 | Open in IMG/M |
| 3300033521|Ga0316616_100809489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1141 | Open in IMG/M |
| 3300033557|Ga0316617_100053385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2527 | Open in IMG/M |
| 3300033816|Ga0334980_0016765 | All Organisms → Viruses → Predicted Viral | 3155 | Open in IMG/M |
| 3300033978|Ga0334977_0000227 | Not Available | 39180 | Open in IMG/M |
| 3300033994|Ga0334996_0103916 | Not Available | 1650 | Open in IMG/M |
| 3300034062|Ga0334995_0541177 | Not Available | 690 | Open in IMG/M |
| 3300034104|Ga0335031_0083692 | All Organisms → Viruses → Predicted Viral | 2265 | Open in IMG/M |
| 3300034106|Ga0335036_0000850 | Not Available | 27990 | Open in IMG/M |
| 3300034106|Ga0335036_0072799 | All Organisms → Viruses → Predicted Viral | 2572 | Open in IMG/M |
| 3300034374|Ga0348335_094339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 963 | Open in IMG/M |
| 3300034375|Ga0348336_105413 | All Organisms → Viruses | 943 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.53% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 11.11% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 10.21% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.60% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.40% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.10% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.50% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.50% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.50% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.20% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.20% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.20% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 1.20% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.20% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.90% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.90% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.90% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.90% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.60% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.60% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.60% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.60% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.60% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.60% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.60% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.30% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.30% |
| Benthic Lake | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Benthic Lake | 0.30% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.30% |
| Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 0.30% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.30% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.30% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.30% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.30% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.30% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.30% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.30% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.30% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001336 | ML7 | Environmental | Open in IMG/M |
| 3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
| 3300001818 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM19, ROCA_DNA029_2.0um_3a | Environmental | Open in IMG/M |
| 3300001828 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM3, ROCA_DNA076_2.0um_10f | Environmental | Open in IMG/M |
| 3300001831 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM4, ROCA_DNA074_0.2um_10l | Environmental | Open in IMG/M |
| 3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
| 3300001846 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25b | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002272 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006562 | Marine microbial communities from the Black Sea in Odessa region - Od_2 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012963 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012966 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013188 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300013231 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 5m_Station5_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018558 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p8 | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025991 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100513992 | 3300000116 | Marine | MNYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSVLKKPDWN* |
| ML7_102221172 | 3300001336 | Benthic Lake | KKGDIFLDKNNNNLYIFDGSKWWEIVPTSYLKQT* |
| MLSed_102514742 | 3300001533 | Benthic | MDIKYKKGDIFLDKNNNNLYIFDGSKWWEIVPTSYLKQT* |
| ACM19_1020141 | 3300001818 | Marine Plankton | MNYQKGDVFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWT* |
| ACM3_10024364 | 3300001828 | Marine Plankton | MNYQKGDVFLDKHTHKLYIFDGNEWWEIVPSSYLKKPDWT* |
| ACM4_10136701 | 3300001831 | Marine Plankton | MNYQKGDVFLDKVTHKLYIFDGKEWWEIVPSSYLKKPDWV* |
| RCM34_10236082 | 3300001843 | Marine Plankton | MTYKKGDIFLDKDTHKLYIFDGNEWWEIVPSCELRKINYEQ* |
| ACM22_10334305 | 3300001846 | Marine Plankton | MGMTYQKGDVFLVKDTRKLYIFDGNEWWEIVPTSELKKSDWT* |
| GOS2236_10014113 | 3300001968 | Marine | NYKKGDFFLDKDTHKLYIFDGEEWWEIVPSCELRKINYEQ* |
| GOS2236_10459752 | 3300001968 | Marine | MTYNKGDIFLDKDTHKLYIFEGNEWWEIVPSCELRKINYEQ* |
| GOS2236_10567242 | 3300001968 | Marine | MGMNYKKGDFFLDKDAHKLYIFDGKEWWEVVPTCELKKPDWI* |
| GOS2236_10634614 | 3300001968 | Marine | MTYTKGDIFLDKDTHKLYIFDGKEWWEIVPDSYLKKLDWT* |
| GOS2236_10785143 | 3300001968 | Marine | MNYKKGDFFLDKDAHKLYIFDGKEWWEIVPTCELRKINYEQ* |
| GOS2236_10865505 | 3300001968 | Marine | MTYKKGDFFLDKDTHKLYIFDGNNWWEIVPICELRKIN |
| B570J29579_1058111 | 3300002272 | Freshwater | RMGMKYNKGDIFLDKDTHKLYIFDGTEWWEIVPTCELKKPDWV* |
| B570J29032_1098623344 | 3300002408 | Freshwater | MKYEKGDYFLDKNTHKLYIFDGNEWWEVVPTSELKKPDWI* |
| B570J40625_10002192416 | 3300002835 | Freshwater | MNYQKGDIFLDKDTHKLYIFDGNEWWEIVPSSYLKKPDWT* |
| B570J40625_10002711812 | 3300002835 | Freshwater | MKYNKGDIFLDKDTHKLYIFDGTEWWEIVPTCELKKPDWV* |
| B570J40625_1000636118 | 3300002835 | Freshwater | MGMKYEKGDYFLDKNTHKLYIFDGNEWWEVVPTSELKKPDWI* |
| B570J40625_1012249082 | 3300002835 | Freshwater | MNYEKGDVFLDKDTRKLYIFDGKEWWEIVPSSYLKKPDWI* |
| B570J40625_1015788852 | 3300002835 | Freshwater | MGMKCKKGDFFLDKNTYTVYIFDGNEWWEVVPDSYLKKLIGLNDDK* |
| B570J40625_1016576971 | 3300002835 | Freshwater | MDMRYKKGDFFLDKDTYTVYIFDGNEWWEVVPDCYLKKLIGLNNSFTK* |
| JGI25921J50272_100289333 | 3300003430 | Freshwater Lake | MKYRKGDFFLDKDTYTVYIFDGNEWWEVVPDSYLKKLIGLNDDK* |
| Ga0069718_163801954 | 3300004481 | Sediment | MKYKKGTFFLDKHTHKVYIFDGKEWWEIVPSSYLKKPDWI* |
| Ga0074648_1000029155 | 3300005512 | Saline Water And Sediment | MKYKKGTFFLDKDTHKVYIFDGKEWWEIVPSSYLKKPDWV* |
| Ga0074648_10206395 | 3300005512 | Saline Water And Sediment | MTEQKGDFFLDKDTNVLYIFDGNEWLEIVPTSVLKNKTND* |
| Ga0068876_100194352 | 3300005527 | Freshwater Lake | MGMKYEKGTFFLDKHTHKVYIFDGKEWWEIVPSSYLKKPDWT* |
| Ga0068876_100424246 | 3300005527 | Freshwater Lake | MNYQKGDVFLDKDTHKLYIFDGKEWWEIVPSSKLKKPDWI* |
| Ga0068876_100530532 | 3300005527 | Freshwater Lake | MKCKKGDFFLDKNTYTVYIFDGNEWWEVVPDSYLKKLIGLNDDK* |
| Ga0068876_103666532 | 3300005527 | Freshwater Lake | MGMTYNKGDVFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWT* |
| Ga0049080_100128765 | 3300005582 | Freshwater Lentic | MDMNYQKGDIFLDKDTHKLYIFDGNEWWEIVPSSYLKKPDWT* |
| Ga0074649_100097030 | 3300005613 | Saline Water And Sediment | MYKKGDVFLDKDTRKLYIFDGNEWLEIVPSSYLKKPDWI* |
| Ga0074649_10126448 | 3300005613 | Saline Water And Sediment | MNYENGDLFLDKDTYKLYIFDVNEWCEIVQKSELRKINYES* |
| Ga0074649_10674592 | 3300005613 | Saline Water And Sediment | MNYEKGDVFLDKDTHKLYIFDGKEWWEIIPKSELRKINYES* |
| Ga0078894_110859472 | 3300005662 | Freshwater Lake | MDMKYTKGDTFLDKDAHKLYIFDGNEWWEIVPTCELKKPDWI* |
| Ga0079957_10193497 | 3300005805 | Lake | MKYQKGTFFLDKHTWKVYIFDGKEWWEIVPSSYLKKPDWT* |
| Ga0079957_10636566 | 3300005805 | Lake | MKYTKGDIFLDKNTHKLYIFDGKEWLEIVPTAELKKPDWV* |
| Ga0079957_11709651 | 3300005805 | Lake | MGMRYEKGDSFLDKDTRKLYIFDGKEWWEVVPTCELKKPDWN* |
| Ga0079957_12874493 | 3300005805 | Lake | MKYEKGDFFIEKDTFKMYIFDGNEWWEIVPSYELRKMNYE* |
| Ga0066377_102135573 | 3300005934 | Marine | MNYQKGDIFLDKHTHKLYIFDGNEWWEIVPSSYLKKPDWT* |
| Ga0070743_100072982 | 3300005941 | Estuarine | MGMKYKNGDVFLDRYTHKLYIFDGNEWWEIFPTCELKKPDWI* |
| Ga0073926_101358052 | 3300005943 | Sand | MDMNYQKGDIFLDKDTHKLYIFDGNEWWEIVPSSYLKKPDWV* |
| Ga0075474_101651152 | 3300006025 | Aqueous | MNYQKGDVFLDKDTRKLYIFDGNEWLEIVPTSILKKPDWV* |
| Ga0075470_100053838 | 3300006030 | Aqueous | MNYRKGDCFLDKDTHKLYIFDGTEWWEIVPTSELKKPEWI* |
| Ga0075470_102198772 | 3300006030 | Aqueous | MGMKYKKGTFFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWI* |
| Ga0101390_10012933 | 3300006562 | Marine | MGMTYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSVLKKPDWN* |
| Ga0079301_10085554 | 3300006639 | Deep Subsurface | MDIRYTKGDFFLDKNTYTVYIFDGNEWWEVVPDCYLKKLIGLEYEQ* |
| Ga0075471_1000708611 | 3300006641 | Aqueous | MKYKKGDFFLDKDTYTVYIFDGNEWWEVVPTSELKKPDWI* |
| Ga0075471_100125126 | 3300006641 | Aqueous | MKYKRGDFFLDKDTQKLYIFDGNEWWEVVPDSYLKKLIGFDYDK* |
| Ga0075471_100249622 | 3300006641 | Aqueous | MKYKKGTFFLDKDTHKVYIFDGKEWWEIVPSSYLKKPDWI* |
| Ga0075471_100556062 | 3300006641 | Aqueous | MKYKKGTFFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWI* |
| Ga0070749_100450032 | 3300006802 | Aqueous | MKYQKSDVFLDKDTHKLYIFDGNEWWEIVPSSYLKKPD* |
| Ga0070749_103911221 | 3300006802 | Aqueous | MKYSKGDIFLDKDTHKLYIFDGNEWWEIVPTSELKEPNWT* |
| Ga0070754_100713974 | 3300006810 | Aqueous | MTYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSVLKKPDWN* |
| Ga0070754_101364812 | 3300006810 | Aqueous | MKYNKGDVFLDKNTLKLYIFDGDEWWEIIPTSELKKPNWT* |
| Ga0070754_102392202 | 3300006810 | Aqueous | MTYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWI* |
| Ga0075476_100283143 | 3300006867 | Aqueous | MNYQKGDVFLDKDTHKLYIFDGNEWLEIVPTSVLKKPDWN* |
| Ga0075477_101810581 | 3300006869 | Aqueous | KGKGDIFLDKDAHKLYVFDGNEWWKIVPTSELKKT* |
| Ga0075477_103726852 | 3300006869 | Aqueous | MGMNYQKGDVFLDRETHKLYIFDGNEWLEIVPTSILKKPDWV* |
| Ga0070750_103452871 | 3300006916 | Aqueous | MTYQKGDVFLDKDTHKLYIFDGTEWLEIVPTSILKKPDWI* |
| Ga0075472_100217981 | 3300006917 | Aqueous | KGDFFLDKDTYTVYIFDGNEWWEVVPTSELKKPDWI* |
| Ga0075472_104225772 | 3300006917 | Aqueous | MDMNYRKGDCFLDKDTHKLYIFDGTEWWEIVPTSELKKPEWI* |
| Ga0070745_12175142 | 3300007344 | Aqueous | MGMTYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWT* |
| Ga0070752_11750422 | 3300007345 | Aqueous | MGMNYQKGDVFLDKDTRKLYIFDGNEWLEIVPTSILKKPDWV* |
| Ga0099851_11582833 | 3300007538 | Aqueous | MTYQNGDIILDKDTHKLYIFDGNEWWEIVPTSVLKKPDWI* |
| Ga0099851_12847862 | 3300007538 | Aqueous | MNYQKGDVFLDRETHKLYIFDGNEWLEIVPTSILKKPDWV* |
| Ga0099851_12857872 | 3300007538 | Aqueous | MYNKGDIFLDKDTYKLYIFDGNEWWEVVPTSELKKPDWT* |
| Ga0099851_12942112 | 3300007538 | Aqueous | MNYQKGDVFLDKHTHKLYIFDGNEWLEIVPTSVLKKPDWV* |
| Ga0099849_100378013 | 3300007539 | Aqueous | MTYQMGDVFLDKDTHKLYIFDGTEWLEIVPTSILKKPDWN* |
| Ga0099849_11532152 | 3300007539 | Aqueous | MNYQKGDVFLDKDTHKLYIFDGSEWWEIVPASVLKKPDWT* |
| Ga0099849_11574505 | 3300007539 | Aqueous | LVKKEIVMKYNKGDIFLHKYTHKLYIYDGNEWLEIVPSSYLKKPDWL |
| Ga0099849_12195092 | 3300007539 | Aqueous | MTYQRGDVFLDKDTHKLYIFDGTEWLEIVPTSVLKKT* |
| Ga0099849_12369312 | 3300007539 | Aqueous | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWV* |
| Ga0099849_13062751 | 3300007539 | Aqueous | MNYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSVLKKPD |
| Ga0099849_13295241 | 3300007539 | Aqueous | MGMNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWI* |
| Ga0099849_13420762 | 3300007539 | Aqueous | MNHQKGDVFLDKVTHKLYIFDGNEWLEIVPTAELKKPYWT* |
| Ga0099847_11902741 | 3300007540 | Aqueous | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWV* |
| Ga0099847_12254873 | 3300007540 | Aqueous | YQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWV* |
| Ga0099848_10435122 | 3300007541 | Aqueous | MNYQKGDVFLHKYTHKLYIFDGKEWLEIVPSSYLKKPDWI* |
| Ga0099848_11299451 | 3300007541 | Aqueous | VGIKYNKGDIFLDKNTHKLYIFDGKEWLEIVPTAELKKPDLT* |
| Ga0099848_11664071 | 3300007541 | Aqueous | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWI* |
| Ga0099848_12729861 | 3300007541 | Aqueous | QRGDLFLDKNTHKLYIFDGNEWREIVPTPELKKPEWV* |
| Ga0099848_12811331 | 3300007541 | Aqueous | QKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWN* |
| Ga0099846_10208986 | 3300007542 | Aqueous | MNYQKGDVFLDKDTHKLYIFDGNEWLEIVPTSILKKPEWV* |
| Ga0099846_11541361 | 3300007542 | Aqueous | NYQKGDVFLDKVTHKLYIFDWKEWLEIVPTSELKNPDWN* |
| Ga0099846_13218331 | 3300007542 | Aqueous | TRMGMNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWI* |
| Ga0099846_13367432 | 3300007542 | Aqueous | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILK |
| Ga0070751_12983251 | 3300007640 | Aqueous | MKYQKSDVFLDKDTHKLYIFDENEWWEIVPSSYLKKPD* |
| Ga0104988_1075725 | 3300007735 | Freshwater | MNYRVGDVFLDKHTRKLYIFDGNEWWEIVPTSELKKPDWN* |
| Ga0099850_10263002 | 3300007960 | Aqueous | MTYQKGDVFLDKDTHKLYIFDGNEWLEIVPTSVLKKPDWI* |
| Ga0099850_12024512 | 3300007960 | Aqueous | MGMNYQKGDIFLDKDTHKLYIFDGNEWLEIVPTSALKKPDWN* |
| Ga0099850_12263663 | 3300007960 | Aqueous | MNYQKGDVFLDKDTWKLYIFDGNEWWEIVPSSYLKKPDW |
| Ga0099850_12827641 | 3300007960 | Aqueous | QKGDVFLDKDTHKLYIFDGTEWLEIVPTSILKKPDWV* |
| Ga0099850_12840152 | 3300007960 | Aqueous | MKHKKGDVFLDKDTFKLYVFDGNEWWEIVPTCELKKPDWT* |
| Ga0099850_13572351 | 3300007960 | Aqueous | MGMNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWI* |
| Ga0105745_12708512 | 3300007972 | Estuary Water | MGMKYNKGDIFLDKDTHKLYIFDGTEWWEIVPTCELKKPDWV* |
| Ga0108970_104144052 | 3300008055 | Estuary | MYKKGDFFLNKYTHKLYIFDGNEWWEIVPNSELKKPDWI* |
| Ga0114340_100261110 | 3300008107 | Freshwater, Plankton | MTYNKGDVFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWT* |
| Ga0114340_100480410 | 3300008107 | Freshwater, Plankton | MKYEKGTFFLDKHTHKVYIFDGKEWWEIVPSSYLKKPDWT* |
| Ga0114346_100243038 | 3300008113 | Freshwater, Plankton | LDEISVGDVFLDKDTHKLYIFDGNGWWEIVPTAELKKLD* |
| Ga0114346_11401583 | 3300008113 | Freshwater, Plankton | MKYQKGDVFLDKDTHKLYIFDGKEWWEIVPSSKLKKPDWI* |
| Ga0114876_10024139 | 3300008448 | Freshwater Lake | MGMNYQKGDYLLDKDKHKLYIFDGNEWWEIVPSSELKKPDWI* |
| Ga0102831_10280073 | 3300008996 | Estuarine | MKYQKGDVFLDKDTWKLYIFDGNEWWEIVPSSYLKKPEWL* |
| Ga0102831_11741722 | 3300008996 | Estuarine | MKYKNGDVFLDRYTHKLYIFDGNEWWEIFPTCELKKPDWI* |
| Ga0102963_10937872 | 3300009001 | Pond Water | MRYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWI* |
| Ga0105105_100500542 | 3300009009 | Freshwater Sediment | MKHKKGDVFLDRDTLKLYIFDGNEWWEIVPTCELKKT* |
| Ga0102957_11072922 | 3300009027 | Pond Water | MIYKKGDIFLDKDTHKLYIFDGNEWLEIVPTSVLKKPDWI* |
| Ga0102830_11320812 | 3300009059 | Estuarine | MKYQKGDVFLDKDTWKLYIFDGNEWWEIVPSSYLKKPDWI* |
| Ga0118687_100663982 | 3300009124 | Sediment | MNYQKGDVFLDKHTHKLYIFDGKEWWEIVPSSYLKKPDWI* |
| Ga0118687_100883811 | 3300009124 | Sediment | MTYQRGDVFLDKDTHKLYIFDGTEWLEIVPTSILKKPDWN* |
| Ga0114918_106662522 | 3300009149 | Deep Subsurface | MNYQKGDIFLNKYTRKLYIFDGNEWWQIVPNSELKKPDWI* |
| Ga0114968_100150093 | 3300009155 | Freshwater Lake | MGMTYEKGDFFLDKDTHKLYVFDGEEWWEIVPSCKLKKPNWI* |
| Ga0114968_105267982 | 3300009155 | Freshwater Lake | MGMTYKKGDFFLDKDTHKLYVFDGEEWWEIVPSCKLKKPNWI* |
| Ga0114978_100099675 | 3300009159 | Freshwater Lake | MNYQKGDIFLDKDTYKLYIFDGNEWWEIVPTSELKKPDWIYNYA* |
| Ga0114970_103527872 | 3300009163 | Freshwater Lake | MTYKKGDFFLDKDTHKLYVFDGEEWWEIVPSCKLKKPNWI* |
| Ga0105102_100718422 | 3300009165 | Freshwater Sediment | MQKGDFFLDKNTYTVYIFDGNEWWEVVPDSYLKKLIGLNDDK* |
| Ga0114974_107103762 | 3300009183 | Freshwater Lake | MNYQKGDIFLDKNTYKLYIFDGNEWWEIVPTSELKKPDWIYNYA* |
| Ga0103858_101033012 | 3300009239 | River Water | MNYKRGDFFLDKDKHKLYIFDGKEWLEIVPSCELRKINYEQ* |
| Ga0129348_10806732 | 3300010296 | Freshwater To Marine Saline Gradient | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPSSYLKKPEWIS* |
| Ga0129348_12183361 | 3300010296 | Freshwater To Marine Saline Gradient | MTYQKGDVFLDKETHKLYIFDGNEWLEIVPTSILKKPDWI* |
| Ga0129348_12369943 | 3300010296 | Freshwater To Marine Saline Gradient | LVKKEIVMKYNKGDIFLHKYTHKLYIYDGNEWLEIVPSSYLKKPDWL* |
| Ga0129348_12882711 | 3300010296 | Freshwater To Marine Saline Gradient | MTYQRGDVFLDKDTHKLYIFDGTEWLEIVPTSVLKKT |
| Ga0129345_10631165 | 3300010297 | Freshwater To Marine Saline Gradient | MTYQIGDIFLDKYTHNLYIFDGKEWLEIVPTSELRKLP* |
| Ga0129345_11170673 | 3300010297 | Freshwater To Marine Saline Gradient | MNYQKGDIFLDKDTHKLYIFDGNEWLEIVPTSALKKPDWN* |
| Ga0129345_13425762 | 3300010297 | Freshwater To Marine Saline Gradient | MTYQRGDVFLDKDTHKLYIFDGTEWWEIVPTSELKKPDWN* |
| Ga0129342_12891572 | 3300010299 | Freshwater To Marine Saline Gradient | MDMNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWV |
| Ga0129342_13174162 | 3300010299 | Freshwater To Marine Saline Gradient | MGMNHQKGDVFLDKVTHKLYIFDGNEWLEIVPTAELKKPYWT* |
| Ga0129342_13410112 | 3300010299 | Freshwater To Marine Saline Gradient | MTYQKGDVFLDRETHKLYIFDGNEWLEIVPTSILKKPDWN* |
| Ga0129351_10534601 | 3300010300 | Freshwater To Marine Saline Gradient | MGMTYQKGDVFLDKNTHKLYIFDGNEWLEIVPSSVLKKPDWN* |
| Ga0129351_11202903 | 3300010300 | Freshwater To Marine Saline Gradient | MMHNKGDIFLDKDTHKLYIFDGNEWWEIIPTCELKKPEWV* |
| Ga0129351_13377662 | 3300010300 | Freshwater To Marine Saline Gradient | MDMNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPD |
| Ga0136656_10539893 | 3300010318 | Freshwater To Marine Saline Gradient | MTYQRGDVFLDKETHKLYIFDGNEWLEIVPTSVLKKPDWI* |
| Ga0129333_101034392 | 3300010354 | Freshwater To Marine Saline Gradient | MNYQKGDIFLHKYTHKLYIFDGKEWWEIVPSSYLKKPDWI* |
| Ga0129333_101349332 | 3300010354 | Freshwater To Marine Saline Gradient | MKYQKGDMFLDKDTQKVYIFDGNEWWEIVLSSYLKKPDWI* |
| Ga0129333_101905672 | 3300010354 | Freshwater To Marine Saline Gradient | MKYKKGDIFLDKDTHKLYIFDGTEWWEIVPDCYLKKLIGLDYESL* |
| Ga0129333_103276122 | 3300010354 | Freshwater To Marine Saline Gradient | MKYNKGDIFLDKDTHKLYIFDGNEWWEIVPTCELKKPNWV* |
| Ga0129333_103429892 | 3300010354 | Freshwater To Marine Saline Gradient | MKYNKGDIFLDKDTHKLYIFDGNEWWEIVPTCELKKPDWV* |
| Ga0129333_104622713 | 3300010354 | Freshwater To Marine Saline Gradient | MKYNKGDIFLDKDTNKLYIFDGTEWWEIVPTCKLKKPDWV* |
| Ga0129333_105013532 | 3300010354 | Freshwater To Marine Saline Gradient | MKYNKGDIFLDKDTHKLYIFDGNEWWEIVPTCELKKPKWI* |
| Ga0129333_106674612 | 3300010354 | Freshwater To Marine Saline Gradient | MKYNKGDIFLDKDTHKLYIFDGTKWWEIVPTCELKKPDWV* |
| Ga0129333_106834781 | 3300010354 | Freshwater To Marine Saline Gradient | MKYKKGTFFLDKDTHKVYIFDGKEWWEIVPSSYLKKPDWN* |
| Ga0129333_107541012 | 3300010354 | Freshwater To Marine Saline Gradient | MKYNKGDIFLDKDTHKLYIFDGTEWWEIVPTCKLKKPDWV* |
| Ga0129333_110438842 | 3300010354 | Freshwater To Marine Saline Gradient | MKYKKGDIFLDKNTHKLYIFDGTEWWEIVPTCELKKPDWT* |
| Ga0129333_113494362 | 3300010354 | Freshwater To Marine Saline Gradient | MKYTKGDIFLDKNTHKLYIFDGKEWLEIVPTAELKKPDWT* |
| Ga0129333_115270471 | 3300010354 | Freshwater To Marine Saline Gradient | MGMKYKKGTFFLDKHTHKVYIFDGKEWWEIVPSSYLKKPDWN* |
| Ga0129333_117455432 | 3300010354 | Freshwater To Marine Saline Gradient | MKYNKGDIFLDKDTHKLYIFDGNEWWEIVPTSELKKPDWV* |
| Ga0129333_117542801 | 3300010354 | Freshwater To Marine Saline Gradient | MNYQKGDIFLDKDTHKLYIFDGTEWWEIVPTCELKKPDWV* |
| Ga0129324_101857511 | 3300010368 | Freshwater To Marine Saline Gradient | LVKKEIVMKYNKGDIFLHKYTHKLYIYDGNEWLEIVPS |
| Ga0129324_103307262 | 3300010368 | Freshwater To Marine Saline Gradient | MGMTYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWN* |
| Ga0129324_103829592 | 3300010368 | Freshwater To Marine Saline Gradient | MGMNYQKGDVFLDKVRHKLYIFDGNEWLEIVPTSVLKKPDWI* |
| Ga0129336_101374182 | 3300010370 | Freshwater To Marine Saline Gradient | MKYKKGTFFLDKHTHKVYIFDGKEWWEIVPSSYLKKPDWN* |
| Ga0129336_105026052 | 3300010370 | Freshwater To Marine Saline Gradient | MDMNYQKGDIFLDKDTHKLYIFDGTEWWEIVPTCELKKPDWV* |
| Ga0136549_100042046 | 3300010389 | Marine Methane Seep Sediment | MRYRKGDIFLDKYTLKLYIFDGKGWLEIISSCELKKN* |
| Ga0136549_100225562 | 3300010389 | Marine Methane Seep Sediment | MDMNYQKGDFFLDKDTHKLYIFDGNKWWEIVPSCELRKINYEQ* |
| Ga0136549_101826722 | 3300010389 | Marine Methane Seep Sediment | MIYKKGDIFLDKDTHKLYIFDGNEWLEIVPTYELKKPDWI* |
| Ga0151620_10071606 | 3300011268 | Freshwater | MKYEKGDYFLDKDTYKLYIFDGNEWWEVVPTSELKKPDWI* |
| Ga0151620_10646341 | 3300011268 | Freshwater | MKYQKGDVFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWI* |
| Ga0119955_10337102 | 3300012006 | Freshwater | MGMTYKKGDFFLDKDTLKLYIFDGNEWWEIIPSSELKKPEWI* |
| Ga0129344_11861624 | 3300012520 | Aqueous | MTYQKGDVFLDKHTHKLYIFDGNEWLEIVPTSVLKKPDWI* |
| Ga0129344_11970042 | 3300012520 | Aqueous | MTYQKGDVFLDKNTHKLYVFDGNEWLEIIPTSVLKKPDWI* |
| Ga0129344_12117062 | 3300012520 | Aqueous | MKYNKGDIFLHKYTHKLYIYDGNEWLEIVPSSYLKKPDWL* |
| Ga0129344_14311533 | 3300012520 | Aqueous | MGMNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWV* |
| Ga0129353_10824701 | 3300012525 | Aqueous | YQMGDVFLDKDTHKLYIFDGTEWLEIVPTSILKKPDWN* |
| Ga0129340_11341942 | 3300012963 | Aqueous | DVFLDKDTHKLYIFDGTEWLEIVPTSILKKPDWN* |
| Ga0129341_10013411 | 3300012966 | Aqueous | MGMTYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSILKKPDWN* |
| Ga0129341_12305641 | 3300012966 | Aqueous | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWN* |
| Ga0129341_12595853 | 3300012966 | Aqueous | MGMNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWV* |
| Ga0129343_11154412 | 3300012967 | Aqueous | MGMTYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWV* |
| Ga0129343_12105567 | 3300012967 | Aqueous | MNYQKGDVFLDKITHKLYIFDGNEWLEIVPTSVLKKPDWV* |
| Ga0129338_12209161 | 3300012970 | Aqueous | MGMKYNKGDIFLDKDTHKLYIFDGTEWWEIIPTCELKKPDWV* |
| (restricted) Ga0172368_103364211 | 3300013123 | Freshwater | YEKGTFFLDRYTHKVYIFDGKEWWEIVPSSYLKKPDWT* |
| (restricted) Ga0172369_104462072 | 3300013125 | Freshwater | MKYEKGTFFLDRYTHKVYIFDGKEWWEIVPSSYLKKPDWT* |
| (restricted) Ga0172367_102240603 | 3300013126 | Freshwater | PSPAPTQTRMGMKYEKGTFFLDRYTHKVYIFDGKEWWEIVPSSYLKKPDWV* |
| Ga0116834_11242973 | 3300013188 | Marine | MTEEQKGDFFLDKDTSVLYIFDGNEWLEIVPTSVLKKPKTNEYP* |
| Ga0116832_10919312 | 3300013231 | Marine | MGMTYQKGDVFLDKNTHKLHFFDGNEWLEIVPTSALNKPDWN* |
| Ga0119954_10007028 | 3300014819 | Freshwater | MDMTYKKGDFFLDKNTYNLYVFDGEQWWEIIPSSELKKPEWI* |
| Ga0181584_100895705 | 3300017949 | Salt Marsh | MGMTYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSVLKKPDWN |
| Ga0181584_102319122 | 3300017949 | Salt Marsh | MNYQKGDVFLDKDTHKLYIFDGNEWLEIVPISVLKKPDWT |
| Ga0181577_101223683 | 3300017951 | Salt Marsh | MNYQKGDVFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWV |
| Ga0181583_100428192 | 3300017952 | Salt Marsh | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPSSYLKKPEWIS |
| Ga0181583_101480824 | 3300017952 | Salt Marsh | MNYQKGDVFLDKDTHKLYIFDGNEWLEIVPTSVLKKPDWT |
| Ga0181583_104934022 | 3300017952 | Salt Marsh | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWN |
| Ga0181580_103787481 | 3300017956 | Salt Marsh | MNYQKGDVFLDKDTHKLYIFDGNEWLEIVPTSVLKKPDW |
| Ga0181580_106221302 | 3300017956 | Salt Marsh | MTYQKGDVFLDKFTHKLYIFDGNEWLEIVPTSVLKKPDWV |
| Ga0181581_100786972 | 3300017962 | Salt Marsh | MTYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSVLKKPDWN |
| Ga0181581_103727762 | 3300017962 | Salt Marsh | MNYQKGDVFLDKHTHKLYIFDGNEWLEIVPTSVLKKPDWT |
| Ga0181581_107812022 | 3300017962 | Salt Marsh | MNYQKGDVFLDKDTHKLYIFDGNEWLEIVPTFVLKKPDWT |
| Ga0180437_100618505 | 3300017963 | Hypersaline Lake Sediment | MGMNYQKGDFFLDKDTRKLYIFDGKEWWEIVPTCELKKPYWI |
| Ga0181590_101878822 | 3300017967 | Salt Marsh | MNYQKGDVFLDKDTWKLYIFDGNEWWEIVPASVLKKPDWT |
| Ga0181590_109722781 | 3300017967 | Salt Marsh | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPD |
| Ga0180438_102870772 | 3300017971 | Hypersaline Lake Sediment | MNYKKGDFFLDKENHNLYIFDGKEWLEIVPKCKLRKN |
| Ga0180433_100653951 | 3300018080 | Hypersaline Lake Sediment | MNYKKGDFFLDKENHNLYVFDGKEWLEIVPKCKLRKINYES |
| Ga0188836_1001462 | 3300018558 | Freshwater Lake | MNYQKGDIFLDKDTHKLYIFDGNEWWEIVPSSYLKKPDWN |
| Ga0194023_10417712 | 3300019756 | Freshwater | MGMTYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWI |
| Ga0194113_102549672 | 3300020074 | Freshwater Lake | MKYEKGTFFLDRYTHKVYIFDGKEWWEIVPSSYLKKPDWT |
| Ga0194113_102680333 | 3300020074 | Freshwater Lake | MKYEKGTFFLDRYTHKVYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0194111_104342361 | 3300020083 | Freshwater Lake | MKYEKGTFFLDRYTHKLYIFDGKEWWEIVPSSYLKKPDWIES |
| Ga0194110_101840363 | 3300020084 | Freshwater Lake | MKYEKGTFFLDRYTHKLYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0211726_103203952 | 3300020161 | Freshwater | MKYKKGTFFLDKHTHKVYIFDGKEWWEIVPSSYLKKPDWN |
| Ga0181578_104011603 | 3300020189 | Salt Marsh | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWV |
| Ga0208050_10016943 | 3300020498 | Freshwater | MNYQKGDIFLDKDTHKLYIFDGNEWWEIVPSSYLKKPDWT |
| Ga0208050_10257462 | 3300020498 | Freshwater | MKYNKGDIFLDKDTHKLYIFDGTEWWEIVPTCELKKPDWV |
| Ga0208091_10018445 | 3300020506 | Freshwater | MGMKYEKGDYFLDKNTHKLYIFDGNEWWEVVPTSELKKPDWI |
| Ga0208855_10038636 | 3300020553 | Freshwater | MKYEKGDYFLDKNTHKLYIFDGNEWWEVVPTSELKKPDWI |
| Ga0208723_10541553 | 3300020571 | Freshwater | MGMKYEKGDYFLDKNTHKLYIFDGNEWWEVVPTSELKKPD |
| Ga0214163_10250122 | 3300021141 | Freshwater | MDMKYKKGTFFLDRYTHKVYVFDGKEWWEIVPSSYLKKPDWI |
| Ga0213858_100499164 | 3300021356 | Seawater | MRYQKGDVFLDKDTHKLYIFDGNEWLEIVPTSILKKPDWV |
| Ga0213859_102819373 | 3300021364 | Seawater | MRYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWV |
| Ga0213865_1000121517 | 3300021373 | Seawater | MTYQKGDVFLDKETHKLYIFDGTEWLEIVPTSILKKPDWN |
| Ga0213865_100117743 | 3300021373 | Seawater | MTYQRGDVFLDKDTHKLYIFDGEYWYEVVPNCELRKLN |
| Ga0213864_100131954 | 3300021379 | Seawater | MNYQKGDVFLDKVTHKLYIFDGNEWLEIIPTSILKKPDWV |
| Ga0213864_100611175 | 3300021379 | Seawater | MNYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSVLKK |
| Ga0213868_104198212 | 3300021389 | Seawater | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWI |
| Ga0213866_104739502 | 3300021425 | Seawater | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWV |
| Ga0222717_101366342 | 3300021957 | Estuarine Water | MNYQKGDVFLDKDTHKLYIFDGSEWWEIVPASVLKKPDWI |
| Ga0222718_100149282 | 3300021958 | Estuarine Water | MTYQKGDVFLDRETHKLYIFDGNEWLEIVPTSILKKPDWN |
| Ga0222716_102203342 | 3300021959 | Estuarine Water | MKYKKGTFFLDKDTHKLYIFDGNEWWEIVPSSYLKKPDWI |
| Ga0222716_102999902 | 3300021959 | Estuarine Water | MNYHKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWV |
| Ga0222716_104492782 | 3300021959 | Estuarine Water | MTYQKGDFFLDKDTHKLYIFDGNEWWEIVPTSELKKPDWN |
| Ga0222716_106781352 | 3300021959 | Estuarine Water | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKK |
| Ga0222715_100010642 | 3300021960 | Estuarine Water | MNYQKGDVFLDKHTHKLYIFDGNEWWEIVPSSYLKKPDWV |
| Ga0222715_100026366 | 3300021960 | Estuarine Water | MTYQKGTFFLDKHTHKVYIFDGKEWWEIVPSSYLKKPDWT |
| Ga0222715_100057575 | 3300021960 | Estuarine Water | MNYQKGDFFLDKHTHKVYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0222715_1000633912 | 3300021960 | Estuarine Water | MNYQRGDVFLDKETHKLYIFDGNEWLEIIPTSVLKKPDWI |
| Ga0222715_100086453 | 3300021960 | Estuarine Water | MNYQKGDVFLDKNTHKLYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0222715_100104558 | 3300021960 | Estuarine Water | MKYQKGDVFLDKDTCKLYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0222715_100174235 | 3300021960 | Estuarine Water | MNYQKGDVFLDKDTWKLYIFDGNEWWEIVPASVLKKPDWI |
| Ga0222715_100406184 | 3300021960 | Estuarine Water | MGVNYQKGDVFLDKDTHKLYIFDGNEWWEIVPTSELKKPDWI |
| Ga0222715_101279982 | 3300021960 | Estuarine Water | MNYQKGDVFLDKDTHKLYIFDGKEWWEIVPASVLKKPDWI |
| Ga0222715_102843611 | 3300021960 | Estuarine Water | MKYKKGTFFLDKDTHKLYIFDGKEWWEIVPSSYLKKP |
| Ga0222715_105236052 | 3300021960 | Estuarine Water | MNYQKGDVFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWT |
| Ga0222715_105239551 | 3300021960 | Estuarine Water | MNYQKGDVFLDKDTHKLYIFDGNEWWEIVPTSKLKKPDWT |
| Ga0222715_105576212 | 3300021960 | Estuarine Water | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWN |
| Ga0222715_106243432 | 3300021960 | Estuarine Water | MNYQKGDCFLDKDTHKLYIFDGTEWWEIVPTSELKKPEWI |
| Ga0222714_1000291120 | 3300021961 | Estuarine Water | MDMNYQKGDFFLDKHTHKVYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0222714_1000490510 | 3300021961 | Estuarine Water | MIYSKGDIFLDKDTHKLYIFDGNEWWEIIPTTELKKPNWI |
| Ga0222714_100068663 | 3300021961 | Estuarine Water | MNYQKGNVFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWT |
| Ga0222714_100091101 | 3300021961 | Estuarine Water | MKYKKGTFFLDKDTHKVYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0222714_100328722 | 3300021961 | Estuarine Water | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWI |
| Ga0222714_100526351 | 3300021961 | Estuarine Water | MKYQKGDVFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0222714_101008344 | 3300021961 | Estuarine Water | MTYQKGDVFLDKETHKLYIFDGNEWLEIVPTSILKKPDWN |
| Ga0222714_101104952 | 3300021961 | Estuarine Water | MTYQKGDVFLDKDTHKLYVFDGNEWLEIIPTSVLKKPDWI |
| Ga0222714_101855653 | 3300021961 | Estuarine Water | MGMKYKKGTFFLDKDTHKVYIFDGKEWWEIVPSSYLKKPDWT |
| Ga0222714_102323142 | 3300021961 | Estuarine Water | MKYSKGDIFLDKDTHKLYIFDGNEWWEIVPTSELKEPNWT |
| Ga0222714_102988903 | 3300021961 | Estuarine Water | TRMGMSYQKGDVFLDKDTHKLYIFDGKEWLEIVPSSYLKKPEWID |
| Ga0222714_103277231 | 3300021961 | Estuarine Water | MNYQKGDFFLDKDTHKVYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0222714_104086182 | 3300021961 | Estuarine Water | MNYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSLLKKPDWV |
| Ga0222714_105174171 | 3300021961 | Estuarine Water | MKYKKGTFFLDKDTHKVYIFDGKEWWEIVPSSYLKKPDWT |
| Ga0222712_100402126 | 3300021963 | Estuarine Water | MKYKKGDIFLDKDTHKLYIFDGTEWWEIVPTCELKKPDWV |
| Ga0222719_101122932 | 3300021964 | Estuarine Water | MTYQRGDVFLDKDTHKLYIFDGTEWLEIVPTSILKKPDWN |
| Ga0222719_106247552 | 3300021964 | Estuarine Water | MTYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWI |
| Ga0181353_10193054 | 3300022179 | Freshwater Lake | MDMNYQKGDIFLDKDTHKLYIFDGNEWWEIVPSSYLKKPDWT |
| Ga0196899_10743553 | 3300022187 | Aqueous | MNYQKGDVFLDKDTRKLYIFDGNEWLEIVPTSILKKPDWV |
| Ga0196901_10192861 | 3300022200 | Aqueous | MNYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSVLKKPDWN |
| Ga0224500_100291432 | 3300022213 | Sediment | MKYQKGTFFLDKHTHKVYIFDGNEWWEIVPSSYLKKPDWT |
| Ga0214917_100645074 | 3300022752 | Freshwater | MTYKKGDFFLDKDTLKLYIFDGNEWWEIIPSSELKKPEWI |
| Ga0255751_100234839 | 3300023116 | Salt Marsh | MNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWT |
| Ga0255751_100452605 | 3300023116 | Salt Marsh | MNYQKGDVFLDKDTHKLYIFDGSEWWEIVPASVLKKPDWT |
| Ga0255751_105054462 | 3300023116 | Salt Marsh | MTYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWN |
| Ga0255751_105880112 | 3300023116 | Salt Marsh | MGMTYQKGDVFLDKFTHKLYIFDGNEWLEIVPTSVLKKPDWV |
| Ga0214923_100004769 | 3300023179 | Freshwater | MGMTYKKGDFFLDKDTLKLYIFDGNEWWEIIPSSELKKPEWI |
| Ga0244775_100180267 | 3300024346 | Estuarine | MKYKNGDVFLDRYTHKLYIFDGNEWWEIFPTCELKKPDWI |
| Ga0244775_101878713 | 3300024346 | Estuarine | MKYQKGDVFLDKDTWKLYIFDGNEWWEIVPSSYLKKPEWL |
| Ga0244775_102298022 | 3300024346 | Estuarine | MTYQKGDFVIDKDTQKLYIFDGEYWYEVVPSYELRRVNFE |
| Ga0209615_1097611 | 3300025075 | Freshwater | MTYEKGDFFLDKDTHKLYVFDGEEWWEIVPSCKLKK |
| Ga0209645_10216583 | 3300025151 | Marine | MKYQKGDIFLHKYTHKLYIFDGNEWCEIVPSSYLKKSIDLL |
| Ga0208303_10061787 | 3300025543 | Aqueous | MKYNKGDIFLHKYTHKLYIYDGNEWLEIVPSSYLKKPDWL |
| Ga0208546_10046618 | 3300025585 | Aqueous | MNYRKGDCFLDKDTHKLYIFDGTEWWEIVPTSELKKPEWI |
| Ga0208546_10656302 | 3300025585 | Aqueous | MKYKKGTFFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0208546_11050942 | 3300025585 | Aqueous | MKYKRGDFFLDKDTQKLYIFDGNEWWEVVPDSYLKKLIGFDYDK |
| Ga0208161_11224782 | 3300025646 | Aqueous | MNYQKGDVFLHKYTHKLYIFDGKEWLEIVPSSYLKKPDWI |
| Ga0208160_11290283 | 3300025647 | Aqueous | RMGMTYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWV |
| Ga0208428_10704341 | 3300025653 | Aqueous | MTYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSVLKKP |
| Ga0208162_10003057 | 3300025674 | Aqueous | MTYQMGDVFLDKDTHKLYIFDGTEWLEIVPTSILKKPDWN |
| Ga0208162_10416344 | 3300025674 | Aqueous | RMGMNYQKGDVFLDKHTHKLYIFDGNEWLEIVPTSVLKKPDWV |
| Ga0208162_10639834 | 3300025674 | Aqueous | MGMNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWV |
| Ga0208162_10712692 | 3300025674 | Aqueous | MTYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWV |
| Ga0208162_10879284 | 3300025674 | Aqueous | RMGMNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSILKKPDWI |
| Ga0208162_11213302 | 3300025674 | Aqueous | MNYQKGDVFLDRETHKLYIFDGNEWLEIVPTSILKKPDWV |
| Ga0208162_11268243 | 3300025674 | Aqueous | MTYQNGDIILDKDTHKLYIFDGNEWWEIVPTSVLKKPDWI |
| Ga0208019_10422874 | 3300025687 | Aqueous | MNYQKGDIFLDKDTHKLYIFDGNEWLEIVPTSALKKPDWN |
| Ga0208019_12086492 | 3300025687 | Aqueous | MTYQRGDVFLDKDTHKLYIFDGTEWWEIVPTSELKKPD |
| Ga0208784_100051116 | 3300025732 | Aqueous | MKYKKGDFFLDKDTYTVYIFDGNEWWEVVPTSELKKPDWI |
| Ga0208784_10212694 | 3300025732 | Aqueous | MGMKYKKGTFFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0208150_12003542 | 3300025751 | Aqueous | MKYNKGDVFLDKNTLKLYIFDGDEWWEIIPTSELKKPNWT |
| Ga0210128_10914292 | 3300025991 | Natural And Restored Wetlands | MGMTYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWT |
| Ga0208880_10467241 | 3300026085 | Marine | NYQKGDVFLDKDTHKLYIFDGSEWWEIVPASVLKKPDWT |
| Ga0208788_10032353 | 3300027499 | Deep Subsurface | MDIRYTKGDFFLDKNTYTVYIFDGNEWWEVVPDCYLKKLIGLEYEQ |
| Ga0255072_10359232 | 3300027508 | Freshwater | MKYNKGDIFLDKDTHKLYIFDGSEWWEIVPTCELKKPDWV |
| Ga0255077_10632341 | 3300027529 | Freshwater | MKYNKGDIFLDKDTHKLYIFDGSEWWEIVPTCELKK |
| Ga0209704_10563932 | 3300027693 | Freshwater Sediment | MKCKKGDFFLDKNTYTVYIFDGNEWWEVVPDSYLKKLIGLNDDK |
| Ga0209190_11543372 | 3300027736 | Freshwater Lake | MTYKKGDFFLDKDTHKLYVFDGEEWWEIVPSCKLKKPNWI |
| Ga0209596_100126323 | 3300027754 | Freshwater Lake | MTYEKGDFFLDKDTHKLYVFDGEEWWEIVPSCKLKKPNWI |
| Ga0209500_1000029020 | 3300027782 | Freshwater Lake | MNYQKGDIFLDKDTYKLYIFDGNEWWEIVPTSELKKPDWIYNYA |
| Ga0209990_101047662 | 3300027816 | Freshwater Lake | MGMKCKKGDFFLDKNTYTVYIFDGNEWWEVVPDSYLKKLIGLNDDK |
| Ga0209635_101438122 | 3300027888 | Marine Sediment | MGMTYQKGDVFLDKETHKLYIFDGNEWLEIVPTSVLKKPDWN |
| Ga0209550_108507531 | 3300027892 | Freshwater Lake | YFSKASRMGMKYEKGDYFLDKNTHKLYIFDGNEWWEVVPTSELKKPDWI |
| Ga0209536_1002674422 | 3300027917 | Marine Sediment | MTYQKGDVFLDKDTHKLYIFDGNEWLEIVPTSVLKKPDWI |
| Ga0209536_1018342641 | 3300027917 | Marine Sediment | GMNYQKGDVFLDKVTHKLYIFDGNEWLEIVPTSVLKKPDWV |
| Ga0209536_1022599842 | 3300027917 | Marine Sediment | MKYQKGDVFLDKDALKLYIFDGNEWWEIVPTCELKKPDWT |
| Ga0209536_1027790643 | 3300027917 | Marine Sediment | MTYQKGDVFLDKETHKLYIFDGNEWLEIVPTSILKKPDW |
| Ga0119944_10042174 | 3300029930 | Aquatic | MKYEKGDYFLDKDTHKLYIFDGNEWWEVVPTSELKKPDWT |
| Ga0119944_10121982 | 3300029930 | Aquatic | MKYKKGTFFLDKDTHKVYIFDGKEWWEIVPSSYLKKPDWN |
| Ga0119944_10355172 | 3300029930 | Aquatic | MKYKKGTFFLDKNTHKVYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0119945_10114223 | 3300029933 | Aquatic | MGMKYKKGTFFLDKDTHKVYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0307380_101574612 | 3300031539 | Soil | VKYQKGDVFLDKDTHKLYIFDGNEWWEIVPSSYLKKPDWI |
| Ga0307380_102183573 | 3300031539 | Soil | MNYQKGDVFLDKNTHKLYIFDGNEWLEIVPTSVLKKPDWV |
| Ga0307380_105343123 | 3300031539 | Soil | MYKKGDVFLDKDTRKLYIFDGNEWWEIVPSSYLKKPDWI |
| Ga0307379_102825723 | 3300031565 | Soil | MGMNYQKGDIFLNKYTRKLYIFDGNEWWQIVPNSELKKPDWI |
| Ga0307377_110703602 | 3300031673 | Soil | VKYQKGDVFLDKDTRKLYIFDGNEWWEIVPSSYLKKPDWI |
| Ga0315293_103988502 | 3300031746 | Sediment | MKYEKGDYFLGKDTHKLYIFDGNEWWEVVPTSELKKPDWT |
| Ga0315907_104066472 | 3300031758 | Freshwater | MGMKYNKGDIFLDKDTHKLYIFDGTEWWEIVPTCELKKPDWV |
| Ga0315899_100508947 | 3300031784 | Freshwater | MNYQKGDIFLDKDTHQLYIFDGNEWWEIVPSSYLKKPDWI |
| Ga0315899_105262743 | 3300031784 | Freshwater | MTYNKGDVFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDWT |
| Ga0315909_105732102 | 3300031857 | Freshwater | MTYQKGDVFLDKVTHKLYIFDGNEWWEIVPTSELKKPDWN |
| Ga0315904_102898361 | 3300031951 | Freshwater | MDMNYQKGDIFLDKDTHQLYIFDGNEWWEIVPSSYLKKPDWT |
| Ga0315274_112331241 | 3300031999 | Sediment | MGMKYKKGDFFLDKDTYTVYIFDGNEWWEFVPDCYLKKLIGLDYESL |
| Ga0315906_103757571 | 3300032050 | Freshwater | MTYNKGDVFLDKDTHKLYIFDGKEWWEIVPSSYLKKPDW |
| Ga0315906_109812412 | 3300032050 | Freshwater | MGMNYQKGDVFLDKDTHKLYIFDGKEWWEIVPSSKLKKPDWI |
| Ga0316625_1001407942 | 3300033418 | Soil | MKYSKGDIFLDRDTHKLYIFDGNEWWEIVPACELKKPDWI |
| Ga0316621_107867792 | 3300033488 | Soil | MKYKKGDFFLDKDTYTVYIFDGNEWWEVVPDSYLKKLIGLNDDK |
| Ga0316616_1008094891 | 3300033521 | Soil | MGMKYKKGDFFLDKDTYTVYIFDGNEWWEVVPDCYLKKLIGLNDGK |
| Ga0316617_1000533855 | 3300033557 | Soil | MGMKYSKGDIFLDRDTHKLYIFDGNEWWEIVPACELKKPDWI |
| Ga0316617_1008141711 | 3300033557 | Soil | MKYNKGDLFLDKDTYTVYIFDGNEWLEIVPTSKIVRTCKLKKL |
| Ga0334980_0016765_1185_1313 | 3300033816 | Freshwater | MGMKYEKGDYFLDKDTHKLYIFDGNEWWEVVPTSELKKPDWI |
| Ga0334977_0000227_9361_9489 | 3300033978 | Freshwater | MGMNYEKGDVFLDKDTRKLYIFDGKEWWEIVPSSYLKKPDWI |
| Ga0334996_0103916_34_174 | 3300033994 | Freshwater | MDMKCKKGDFFLDKNTYTVYIFDGNEWWEVVPDSYLKKLIGLNDDK |
| Ga0334995_0541177_459_599 | 3300034062 | Freshwater | MGMKYKKGDFFLDKDTYTVYIFDGNEWWEVVPDCYLKKLIGLDYEQ |
| Ga0335031_0083692_155_280 | 3300034104 | Freshwater | MTYQKGDFFLDRYTQKFYIFDGNEWMEIIPTCELKKINYES |
| Ga0335036_0000850_7729_7869 | 3300034106 | Freshwater | MGIKYKKGDFFLDKYTCTVYIFDGNEWWEVVPDSYLKKLIGFNDGK |
| Ga0335036_0072799_2334_2462 | 3300034106 | Freshwater | MGMKYNKGDIFLDKDTHKLYIFDGNEWWEIVPSSYLKKPDWT |
| Ga0348335_094339_450_578 | 3300034374 | Aqueous | MGMNYQKGDVFLDKDTRKLYIFDGNEWLEIVPTSILKKPDWV |
| Ga0348336_105413_2_112 | 3300034375 | Aqueous | MKYNKGDVFLDKNTLKLYIFDGDEWWEIIPTSELKKP |
| ⦗Top⦘ |