| Basic Information | |
|---|---|
| Family ID | F006851 |
| Family Type | Metagenome |
| Number of Sequences | 363 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MARAAKLDLRTFQQELATRLASKTAAQVESSRLGLACGGEQWLLR |
| Number of Associated Samples | 282 |
| Number of Associated Scaffolds | 363 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.22 % |
| % of genes near scaffold ends (potentially truncated) | 99.45 % |
| % of genes from short scaffolds (< 2000 bps) | 93.66 % |
| Associated GOLD sequencing projects | 265 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.421 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (8.540 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.956 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.190 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.58% β-sheet: 0.00% Coil/Unstructured: 53.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 363 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 92.01 |
| PF00585 | Thr_dehydrat_C | 6.61 |
| PF13090 | PP_kinase_C | 0.55 |
| PF08340 | DUF1732 | 0.28 |
| PF02897 | Peptidase_S9_N | 0.28 |
| COG ID | Name | Functional Category | % Frequency in 363 Family Scaffolds |
|---|---|---|---|
| COG1171 | Threonine deaminase | Amino acid transport and metabolism [E] | 6.61 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.28 |
| COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.28 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.28 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.28 % |
| Unclassified | root | N/A | 26.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090009|LWAnN_GIDYKCY01CNZBG | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 502 | Open in IMG/M |
| 2124908043|A2_c1_ConsensusfromContig39445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 767 | Open in IMG/M |
| 3300000312|WSSedB2BaDRAFT_1021113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica | 516 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1001886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 4556 | Open in IMG/M |
| 3300003861|Ga0031654_10132735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 702 | Open in IMG/M |
| 3300004011|Ga0055460_10144487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 710 | Open in IMG/M |
| 3300004014|Ga0055456_10295542 | Not Available | 574 | Open in IMG/M |
| 3300004047|Ga0055499_10087387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
| 3300004157|Ga0062590_101257979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 726 | Open in IMG/M |
| 3300004241|Ga0066604_10385116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 562 | Open in IMG/M |
| 3300004782|Ga0062382_10022443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2089 | Open in IMG/M |
| 3300005177|Ga0066690_10960510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 541 | Open in IMG/M |
| 3300005180|Ga0066685_10349030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1027 | Open in IMG/M |
| 3300005181|Ga0066678_10147969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1467 | Open in IMG/M |
| 3300005181|Ga0066678_10681405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 685 | Open in IMG/M |
| 3300005184|Ga0066671_10852488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 580 | Open in IMG/M |
| 3300005186|Ga0066676_11013792 | Not Available | 551 | Open in IMG/M |
| 3300005187|Ga0066675_10084603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2056 | Open in IMG/M |
| 3300005290|Ga0065712_10635223 | Not Available | 574 | Open in IMG/M |
| 3300005335|Ga0070666_10133651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1725 | Open in IMG/M |
| 3300005343|Ga0070687_100458134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 850 | Open in IMG/M |
| 3300005343|Ga0070687_100489058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 826 | Open in IMG/M |
| 3300005343|Ga0070687_100533224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
| 3300005347|Ga0070668_102209347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 508 | Open in IMG/M |
| 3300005353|Ga0070669_100977265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 726 | Open in IMG/M |
| 3300005354|Ga0070675_101556742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 610 | Open in IMG/M |
| 3300005356|Ga0070674_100359449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1178 | Open in IMG/M |
| 3300005367|Ga0070667_101044300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 763 | Open in IMG/M |
| 3300005436|Ga0070713_100024012 | Not Available | 4741 | Open in IMG/M |
| 3300005439|Ga0070711_100681794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 864 | Open in IMG/M |
| 3300005441|Ga0070700_101331111 | Not Available | 605 | Open in IMG/M |
| 3300005445|Ga0070708_100392811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1308 | Open in IMG/M |
| 3300005450|Ga0066682_10653087 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005455|Ga0070663_101913351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 533 | Open in IMG/M |
| 3300005458|Ga0070681_11636662 | Not Available | 569 | Open in IMG/M |
| 3300005471|Ga0070698_102196214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 505 | Open in IMG/M |
| 3300005481|Ga0074210_113469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 863 | Open in IMG/M |
| 3300005487|Ga0074211_112403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 840 | Open in IMG/M |
| 3300005530|Ga0070679_100090444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3049 | Open in IMG/M |
| 3300005543|Ga0070672_102054317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 515 | Open in IMG/M |
| 3300005544|Ga0070686_101917065 | Not Available | 506 | Open in IMG/M |
| 3300005547|Ga0070693_100151671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1469 | Open in IMG/M |
| 3300005547|Ga0070693_100623985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 781 | Open in IMG/M |
| 3300005547|Ga0070693_101481586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 530 | Open in IMG/M |
| 3300005556|Ga0066707_10899198 | Not Available | 543 | Open in IMG/M |
| 3300005563|Ga0068855_100469828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1370 | Open in IMG/M |
| 3300005577|Ga0068857_102438203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 514 | Open in IMG/M |
| 3300005598|Ga0066706_10621199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 857 | Open in IMG/M |
| 3300005616|Ga0068852_101481244 | Not Available | 701 | Open in IMG/M |
| 3300005616|Ga0068852_102079124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 590 | Open in IMG/M |
| 3300005618|Ga0068864_102154977 | Not Available | 564 | Open in IMG/M |
| 3300005618|Ga0068864_102289165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 547 | Open in IMG/M |
| 3300005833|Ga0074472_10488391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 810 | Open in IMG/M |
| 3300005841|Ga0068863_100412272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1323 | Open in IMG/M |
| 3300005956|Ga0073920_1020023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 833 | Open in IMG/M |
| 3300006032|Ga0066696_10554328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 750 | Open in IMG/M |
| 3300006046|Ga0066652_101648174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 587 | Open in IMG/M |
| 3300006050|Ga0075028_100068154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1752 | Open in IMG/M |
| 3300006050|Ga0075028_100542189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 684 | Open in IMG/M |
| 3300006224|Ga0079037_102617990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 502 | Open in IMG/M |
| 3300006237|Ga0097621_101332552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 678 | Open in IMG/M |
| 3300006358|Ga0068871_100919137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 812 | Open in IMG/M |
| 3300006358|Ga0068871_101394230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 661 | Open in IMG/M |
| 3300006642|Ga0075521_10032194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 2213 | Open in IMG/M |
| 3300006755|Ga0079222_10009058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3526 | Open in IMG/M |
| 3300006755|Ga0079222_11541635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 626 | Open in IMG/M |
| 3300006797|Ga0066659_11895090 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 506 | Open in IMG/M |
| 3300006800|Ga0066660_10614764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 907 | Open in IMG/M |
| 3300006806|Ga0079220_11229607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 621 | Open in IMG/M |
| 3300006846|Ga0075430_101510922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 552 | Open in IMG/M |
| 3300006954|Ga0079219_10070860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1594 | Open in IMG/M |
| 3300006954|Ga0079219_10210216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp. | 1114 | Open in IMG/M |
| 3300007076|Ga0075435_100219873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1613 | Open in IMG/M |
| 3300007076|Ga0075435_100403338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1176 | Open in IMG/M |
| 3300009012|Ga0066710_103336217 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300009090|Ga0099827_10289590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1384 | Open in IMG/M |
| 3300009098|Ga0105245_10523948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1204 | Open in IMG/M |
| 3300009098|Ga0105245_11403295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 748 | Open in IMG/M |
| 3300009111|Ga0115026_11675211 | Not Available | 535 | Open in IMG/M |
| 3300009131|Ga0115027_11046123 | Not Available | 643 | Open in IMG/M |
| 3300009148|Ga0105243_10738150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 964 | Open in IMG/M |
| 3300009156|Ga0111538_11781901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 775 | Open in IMG/M |
| 3300009162|Ga0075423_11723673 | Not Available | 675 | Open in IMG/M |
| 3300009162|Ga0075423_12288126 | Not Available | 588 | Open in IMG/M |
| 3300009167|Ga0113563_11155910 | Not Available | 899 | Open in IMG/M |
| 3300009167|Ga0113563_11546957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 783 | Open in IMG/M |
| 3300009174|Ga0105241_10555523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 1031 | Open in IMG/M |
| 3300009174|Ga0105241_11002522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 781 | Open in IMG/M |
| 3300009174|Ga0105241_11589932 | Not Available | 632 | Open in IMG/M |
| 3300009179|Ga0115028_11475933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300009545|Ga0105237_11671287 | Not Available | 644 | Open in IMG/M |
| 3300009551|Ga0105238_11148519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 800 | Open in IMG/M |
| 3300009667|Ga0116147_1278729 | Not Available | 635 | Open in IMG/M |
| 3300009838|Ga0116153_10133826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1031 | Open in IMG/M |
| 3300009840|Ga0126313_11593603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300010343|Ga0074044_10730406 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300010364|Ga0134066_10311447 | Not Available | 569 | Open in IMG/M |
| 3300010366|Ga0126379_10886788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 994 | Open in IMG/M |
| 3300010366|Ga0126379_10894747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 990 | Open in IMG/M |
| 3300010366|Ga0126379_11860130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 706 | Open in IMG/M |
| 3300010366|Ga0126379_12938239 | Not Available | 570 | Open in IMG/M |
| 3300010396|Ga0134126_11440505 | Not Available | 760 | Open in IMG/M |
| 3300010397|Ga0134124_10887269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 897 | Open in IMG/M |
| 3300010398|Ga0126383_11714835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 717 | Open in IMG/M |
| 3300010398|Ga0126383_12370324 | Not Available | 616 | Open in IMG/M |
| 3300010400|Ga0134122_12749396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300010401|Ga0134121_12271109 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300011269|Ga0137392_10185196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1697 | Open in IMG/M |
| 3300011269|Ga0137392_11447404 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300011445|Ga0137427_10033439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2021 | Open in IMG/M |
| 3300012044|Ga0136636_10251337 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012046|Ga0136634_10503563 | Not Available | 516 | Open in IMG/M |
| 3300012189|Ga0137388_10679249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 956 | Open in IMG/M |
| 3300012198|Ga0137364_10546561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 872 | Open in IMG/M |
| 3300012210|Ga0137378_10201321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1853 | Open in IMG/M |
| 3300012285|Ga0137370_10207837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 1150 | Open in IMG/M |
| 3300012469|Ga0150984_117803777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1039 | Open in IMG/M |
| 3300012469|Ga0150984_120003136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1155 | Open in IMG/M |
| 3300012509|Ga0157334_1015846 | Not Available | 777 | Open in IMG/M |
| 3300012511|Ga0157332_1062007 | Not Available | 563 | Open in IMG/M |
| 3300012532|Ga0137373_10637402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 800 | Open in IMG/M |
| 3300012898|Ga0157293_10051006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 920 | Open in IMG/M |
| 3300012906|Ga0157295_10382276 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012916|Ga0157310_10192435 | Not Available | 736 | Open in IMG/M |
| 3300012916|Ga0157310_10362661 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300012927|Ga0137416_10814142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 826 | Open in IMG/M |
| 3300012930|Ga0137407_11496430 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300012951|Ga0164300_10564704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
| 3300012955|Ga0164298_10503020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 810 | Open in IMG/M |
| 3300012958|Ga0164299_10111064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1445 | Open in IMG/M |
| 3300012958|Ga0164299_10372612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 907 | Open in IMG/M |
| 3300012958|Ga0164299_10652421 | Not Available | 728 | Open in IMG/M |
| 3300012971|Ga0126369_11130002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 873 | Open in IMG/M |
| 3300012971|Ga0126369_11906569 | Not Available | 683 | Open in IMG/M |
| 3300012971|Ga0126369_12942958 | Not Available | 558 | Open in IMG/M |
| 3300012971|Ga0126369_13551665 | Not Available | 511 | Open in IMG/M |
| 3300013102|Ga0157371_10286128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1191 | Open in IMG/M |
| 3300013104|Ga0157370_10694912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 928 | Open in IMG/M |
| 3300013297|Ga0157378_10196024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1908 | Open in IMG/M |
| 3300013306|Ga0163162_11275469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 834 | Open in IMG/M |
| 3300013306|Ga0163162_12697709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300013307|Ga0157372_11715612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 722 | Open in IMG/M |
| 3300013307|Ga0157372_12278174 | Not Available | 622 | Open in IMG/M |
| 3300013503|Ga0120127_10022475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1132 | Open in IMG/M |
| 3300013770|Ga0120123_1171746 | Not Available | 519 | Open in IMG/M |
| 3300014313|Ga0075347_1031413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1037 | Open in IMG/M |
| 3300014969|Ga0157376_11543820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 697 | Open in IMG/M |
| 3300015197|Ga0167638_1031450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1213 | Open in IMG/M |
| 3300015371|Ga0132258_12856816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1201 | Open in IMG/M |
| 3300015371|Ga0132258_13862918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1019 | Open in IMG/M |
| 3300015372|Ga0132256_100442767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1406 | Open in IMG/M |
| 3300015373|Ga0132257_100176339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2520 | Open in IMG/M |
| 3300015373|Ga0132257_104081751 | Not Available | 531 | Open in IMG/M |
| 3300015374|Ga0132255_100466844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1850 | Open in IMG/M |
| 3300015374|Ga0132255_105492281 | Not Available | 536 | Open in IMG/M |
| 3300016319|Ga0182033_11527391 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300016357|Ga0182032_11683216 | Not Available | 553 | Open in IMG/M |
| 3300017792|Ga0163161_11884861 | Not Available | 532 | Open in IMG/M |
| 3300017930|Ga0187825_10263754 | Not Available | 634 | Open in IMG/M |
| 3300018027|Ga0184605_10050158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1774 | Open in IMG/M |
| 3300018058|Ga0187766_10251802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1130 | Open in IMG/M |
| 3300018058|Ga0187766_10908214 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300018058|Ga0187766_11206727 | Not Available | 548 | Open in IMG/M |
| 3300018075|Ga0184632_10350724 | Not Available | 631 | Open in IMG/M |
| 3300018081|Ga0184625_10545563 | Not Available | 577 | Open in IMG/M |
| 3300018429|Ga0190272_11633899 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 663 | Open in IMG/M |
| 3300018476|Ga0190274_10440601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1280 | Open in IMG/M |
| 3300018482|Ga0066669_11599865 | Not Available | 595 | Open in IMG/M |
| 3300018920|Ga0190273_12054268 | Not Available | 531 | Open in IMG/M |
| 3300019879|Ga0193723_1115611 | Not Available | 748 | Open in IMG/M |
| 3300019883|Ga0193725_1124804 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300019890|Ga0193728_1191193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 867 | Open in IMG/M |
| 3300020004|Ga0193755_1048134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1396 | Open in IMG/M |
| 3300020059|Ga0193745_1119505 | Not Available | 549 | Open in IMG/M |
| 3300021344|Ga0193719_10106066 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1221 | Open in IMG/M |
| 3300021432|Ga0210384_11184821 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300021445|Ga0182009_10025535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 2301 | Open in IMG/M |
| 3300021445|Ga0182009_10049875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1765 | Open in IMG/M |
| 3300021478|Ga0210402_10255520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1618 | Open in IMG/M |
| (restricted) 3300021518|Ga0224722_1026597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2173 | Open in IMG/M |
| 3300022214|Ga0224505_10148946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 904 | Open in IMG/M |
| 3300022534|Ga0224452_1251110 | Not Available | 541 | Open in IMG/M |
| 3300022756|Ga0222622_10246691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1208 | Open in IMG/M |
| 3300022756|Ga0222622_11365091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300022880|Ga0247792_1148608 | Not Available | 507 | Open in IMG/M |
| 3300022901|Ga0247788_1049883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 778 | Open in IMG/M |
| 3300023064|Ga0247801_1094501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300025315|Ga0207697_10247547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 788 | Open in IMG/M |
| 3300025321|Ga0207656_10112418 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1260 | Open in IMG/M |
| 3300025461|Ga0208851_1055656 | Not Available | 686 | Open in IMG/M |
| 3300025905|Ga0207685_10777615 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 526 | Open in IMG/M |
| 3300025906|Ga0207699_10218730 | Not Available | 1299 | Open in IMG/M |
| 3300025907|Ga0207645_10046586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2769 | Open in IMG/M |
| 3300025908|Ga0207643_10804429 | Not Available | 609 | Open in IMG/M |
| 3300025911|Ga0207654_10561211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 812 | Open in IMG/M |
| 3300025912|Ga0207707_10013735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7062 | Open in IMG/M |
| 3300025914|Ga0207671_10795279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 750 | Open in IMG/M |
| 3300025915|Ga0207693_10598473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 858 | Open in IMG/M |
| 3300025916|Ga0207663_10412719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1035 | Open in IMG/M |
| 3300025916|Ga0207663_10724285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 789 | Open in IMG/M |
| 3300025917|Ga0207660_10473626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1014 | Open in IMG/M |
| 3300025917|Ga0207660_11381209 | Not Available | 571 | Open in IMG/M |
| 3300025921|Ga0207652_10554396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1033 | Open in IMG/M |
| 3300025923|Ga0207681_10629630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 888 | Open in IMG/M |
| 3300025925|Ga0207650_10276633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1366 | Open in IMG/M |
| 3300025927|Ga0207687_11102004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 682 | Open in IMG/M |
| 3300025930|Ga0207701_11026443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300025930|Ga0207701_11486630 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300025931|Ga0207644_10563000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 944 | Open in IMG/M |
| 3300025931|Ga0207644_11360669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300025934|Ga0207686_11676082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 526 | Open in IMG/M |
| 3300025936|Ga0207670_11835004 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300025938|Ga0207704_11193499 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300025940|Ga0207691_10616474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans | 918 | Open in IMG/M |
| 3300025940|Ga0207691_10649534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 891 | Open in IMG/M |
| 3300025940|Ga0207691_11206610 | Not Available | 627 | Open in IMG/M |
| 3300025941|Ga0207711_10013511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans | 6779 | Open in IMG/M |
| 3300025941|Ga0207711_10463313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1180 | Open in IMG/M |
| 3300025942|Ga0207689_11569696 | Not Available | 548 | Open in IMG/M |
| 3300025944|Ga0207661_11561094 | Not Available | 604 | Open in IMG/M |
| 3300025945|Ga0207679_10677179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 935 | Open in IMG/M |
| 3300025945|Ga0207679_11478699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300025981|Ga0207640_10182176 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300025981|Ga0207640_11824059 | Not Available | 550 | Open in IMG/M |
| 3300025986|Ga0207658_10549490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1033 | Open in IMG/M |
| 3300025986|Ga0207658_10834261 | Not Available | 838 | Open in IMG/M |
| 3300026041|Ga0207639_10340279 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1337 | Open in IMG/M |
| 3300026041|Ga0207639_12237866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300026058|Ga0208421_1021489 | Not Available | 589 | Open in IMG/M |
| 3300026067|Ga0207678_11298993 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300026069|Ga0208539_1009546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 879 | Open in IMG/M |
| 3300026078|Ga0207702_12502291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300026088|Ga0207641_11991896 | Not Available | 582 | Open in IMG/M |
| 3300026095|Ga0207676_10813172 | Not Available | 912 | Open in IMG/M |
| 3300026142|Ga0207698_10454612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1237 | Open in IMG/M |
| 3300026142|Ga0207698_11397770 | Not Available | 715 | Open in IMG/M |
| 3300026142|Ga0207698_11770108 | Not Available | 633 | Open in IMG/M |
| 3300026215|Ga0209849_1059519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 670 | Open in IMG/M |
| 3300026309|Ga0209055_1293693 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300026374|Ga0257146_1064770 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300026529|Ga0209806_1197207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 706 | Open in IMG/M |
| 3300027548|Ga0209523_1114416 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300027682|Ga0209971_1040556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1120 | Open in IMG/M |
| 3300027829|Ga0209773_10168941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 913 | Open in IMG/M |
| 3300027831|Ga0209797_10217555 | Not Available | 809 | Open in IMG/M |
| 3300027840|Ga0209683_10039099 | Not Available | 2050 | Open in IMG/M |
| 3300027885|Ga0209450_10063073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2338 | Open in IMG/M |
| 3300027887|Ga0208980_10327628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 887 | Open in IMG/M |
| 3300027897|Ga0209254_10790766 | Not Available | 643 | Open in IMG/M |
| 3300027900|Ga0209253_10637818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 777 | Open in IMG/M |
| 3300028379|Ga0268266_10185935 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300028379|Ga0268266_10929936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 841 | Open in IMG/M |
| 3300028381|Ga0268264_10349313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1407 | Open in IMG/M |
| 3300028381|Ga0268264_11205616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 766 | Open in IMG/M |
| 3300028381|Ga0268264_12146943 | Not Available | 567 | Open in IMG/M |
| 3300028587|Ga0247828_10047558 | Not Available | 1842 | Open in IMG/M |
| 3300028589|Ga0247818_10701875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 701 | Open in IMG/M |
| 3300028590|Ga0247823_10510540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 906 | Open in IMG/M |
| 3300028596|Ga0247821_10203248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1172 | Open in IMG/M |
| 3300028652|Ga0302166_10080292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 712 | Open in IMG/M |
| 3300028652|Ga0302166_10129651 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 577 | Open in IMG/M |
| 3300028679|Ga0302169_10101810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 697 | Open in IMG/M |
| 3300028804|Ga0268298_10217738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 1031 | Open in IMG/M |
| 3300028809|Ga0247824_10925134 | Not Available | 547 | Open in IMG/M |
| 3300028861|Ga0302259_1178125 | Not Available | 532 | Open in IMG/M |
| 3300028870|Ga0302254_10287318 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300029923|Ga0311347_10329111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 932 | Open in IMG/M |
| 3300029984|Ga0311332_11220789 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300029989|Ga0311365_11600065 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300029990|Ga0311336_10090426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2415 | Open in IMG/M |
| 3300029990|Ga0311336_10722148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 855 | Open in IMG/M |
| 3300030000|Ga0311337_10139313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1959 | Open in IMG/M |
| 3300030000|Ga0311337_11935587 | Not Available | 518 | Open in IMG/M |
| 3300030002|Ga0311350_10014629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 6784 | Open in IMG/M |
| 3300030002|Ga0311350_11168496 | Not Available | 686 | Open in IMG/M |
| 3300030002|Ga0311350_11941362 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300030047|Ga0302286_10462178 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 642 | Open in IMG/M |
| 3300030052|Ga0302217_10120374 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300030294|Ga0311349_10276865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1583 | Open in IMG/M |
| 3300030294|Ga0311349_10985820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 790 | Open in IMG/M |
| 3300030294|Ga0311349_11454258 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 636 | Open in IMG/M |
| 3300030339|Ga0311360_11230402 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 588 | Open in IMG/M |
| 3300030838|Ga0311335_10858471 | Not Available | 643 | Open in IMG/M |
| 3300030943|Ga0311366_11545685 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 568 | Open in IMG/M |
| 3300031170|Ga0307498_10121087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 833 | Open in IMG/M |
| 3300031199|Ga0307495_10234608 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031232|Ga0302323_100522331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1276 | Open in IMG/M |
| 3300031232|Ga0302323_101006944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 925 | Open in IMG/M |
| 3300031521|Ga0311364_10625452 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1085 | Open in IMG/M |
| 3300031521|Ga0311364_10983691 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 842 | Open in IMG/M |
| 3300031548|Ga0307408_102511968 | Not Available | 501 | Open in IMG/M |
| 3300031716|Ga0310813_12198135 | Not Available | 522 | Open in IMG/M |
| 3300031720|Ga0307469_10856957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 838 | Open in IMG/M |
| 3300031720|Ga0307469_11229625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 709 | Open in IMG/M |
| 3300031720|Ga0307469_11645708 | Not Available | 618 | Open in IMG/M |
| 3300031722|Ga0311351_10958334 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031724|Ga0318500_10061115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1630 | Open in IMG/M |
| 3300031726|Ga0302321_100804086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1061 | Open in IMG/M |
| 3300031726|Ga0302321_101662588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 738 | Open in IMG/M |
| 3300031731|Ga0307405_10423395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1048 | Open in IMG/M |
| 3300031753|Ga0307477_11018555 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031795|Ga0318557_10476227 | Not Available | 574 | Open in IMG/M |
| 3300031798|Ga0318523_10506726 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031820|Ga0307473_10631960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 743 | Open in IMG/M |
| 3300031834|Ga0315290_11122489 | Not Available | 656 | Open in IMG/M |
| 3300031834|Ga0315290_11215048 | Not Available | 625 | Open in IMG/M |
| 3300031858|Ga0310892_10081148 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300031858|Ga0310892_10228947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 1134 | Open in IMG/M |
| 3300031873|Ga0315297_10113745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2161 | Open in IMG/M |
| 3300031873|Ga0315297_11014540 | Not Available | 686 | Open in IMG/M |
| 3300031890|Ga0306925_10779768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 994 | Open in IMG/M |
| 3300031901|Ga0307406_10001123 | Not Available | 14952 | Open in IMG/M |
| 3300031908|Ga0310900_10034623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2833 | Open in IMG/M |
| 3300031918|Ga0311367_11578343 | Not Available | 642 | Open in IMG/M |
| 3300031918|Ga0311367_11748469 | Not Available | 605 | Open in IMG/M |
| 3300031938|Ga0308175_100312675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 1607 | Open in IMG/M |
| 3300031939|Ga0308174_10852589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 767 | Open in IMG/M |
| 3300031939|Ga0308174_11735333 | Not Available | 536 | Open in IMG/M |
| 3300031941|Ga0310912_10918587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 673 | Open in IMG/M |
| 3300031942|Ga0310916_10451328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1095 | Open in IMG/M |
| 3300031942|Ga0310916_11759642 | Not Available | 500 | Open in IMG/M |
| 3300031996|Ga0308176_12991208 | Not Available | 501 | Open in IMG/M |
| 3300031997|Ga0315278_10950754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 859 | Open in IMG/M |
| 3300031997|Ga0315278_11734597 | Not Available | 592 | Open in IMG/M |
| 3300032002|Ga0307416_103308446 | Not Available | 539 | Open in IMG/M |
| 3300032003|Ga0310897_10616343 | Not Available | 538 | Open in IMG/M |
| 3300032005|Ga0307411_10346775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1209 | Open in IMG/M |
| 3300032008|Ga0318562_10167219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1269 | Open in IMG/M |
| 3300032009|Ga0318563_10609667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300032064|Ga0318510_10459870 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300032075|Ga0310890_10141318 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300032118|Ga0315277_10687932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 987 | Open in IMG/M |
| 3300032126|Ga0307415_100983356 | Not Available | 783 | Open in IMG/M |
| 3300032163|Ga0315281_11241898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 742 | Open in IMG/M |
| 3300032164|Ga0315283_11384626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 725 | Open in IMG/M |
| 3300032174|Ga0307470_10224321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1221 | Open in IMG/M |
| 3300032174|Ga0307470_11905531 | Not Available | 506 | Open in IMG/M |
| 3300032177|Ga0315276_12006068 | Not Available | 590 | Open in IMG/M |
| 3300032205|Ga0307472_102572460 | Not Available | 518 | Open in IMG/M |
| 3300032211|Ga0310896_10815363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300032256|Ga0315271_11107682 | Not Available | 684 | Open in IMG/M |
| 3300032397|Ga0315287_10155065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2649 | Open in IMG/M |
| 3300032397|Ga0315287_10429870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella | 1566 | Open in IMG/M |
| 3300032397|Ga0315287_11805346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300032397|Ga0315287_12397099 | Not Available | 570 | Open in IMG/M |
| 3300032516|Ga0315273_10285756 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 2241 | Open in IMG/M |
| 3300032782|Ga0335082_10885303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 756 | Open in IMG/M |
| 3300032782|Ga0335082_11688926 | Not Available | 507 | Open in IMG/M |
| 3300032829|Ga0335070_11176315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 704 | Open in IMG/M |
| 3300032954|Ga0335083_10199421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1833 | Open in IMG/M |
| 3300033290|Ga0318519_10161805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1257 | Open in IMG/M |
| 3300033412|Ga0310810_10716596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 926 | Open in IMG/M |
| 3300033416|Ga0316622_100904784 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1028 | Open in IMG/M |
| 3300033416|Ga0316622_102355342 | Not Available | 615 | Open in IMG/M |
| 3300033433|Ga0326726_10724549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 960 | Open in IMG/M |
| 3300033433|Ga0326726_11150121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300033482|Ga0316627_100363410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae | 1223 | Open in IMG/M |
| 3300033483|Ga0316629_10281222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1112 | Open in IMG/M |
| 3300033483|Ga0316629_10825038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 714 | Open in IMG/M |
| 3300033488|Ga0316621_10424623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 912 | Open in IMG/M |
| 3300034178|Ga0364934_0366736 | Not Available | 545 | Open in IMG/M |
| 3300034197|Ga0370508_0317514 | Not Available | 518 | Open in IMG/M |
| 3300034268|Ga0372943_0756066 | Not Available | 643 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 8.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.61% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.20% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.20% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.10% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.10% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.83% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.83% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.83% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.28% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.28% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.28% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.28% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.28% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.28% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.28% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.28% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.28% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.28% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.28% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.28% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.28% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.28% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.28% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.28% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.55% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.55% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.55% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.55% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.55% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.55% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate | Environmental | Open in IMG/M |
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 3300000312 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004014 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004241 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005481 | Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methylamine enrichment | Environmental | Open in IMG/M |
| 3300005487 | Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichment | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005956 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
| 3300009838 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG | Engineered | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012044 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ852 (21.06) | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014313 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021518 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR1_MetaG | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026058 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026069 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028804 | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt | Engineered | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030052 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034197 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02S_18 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LWAnN_02159450 | 2088090009 | Freshwater Sediment | MARAARVDLRSFQQELANRLASKTAAQVESSRLGLACGGQRWLVRLVDAAEVVAVPPIAAVP |
| A2_c1_00510740 | 2124908043 | Soil | MARAGKLNLRAFQQELATRLAAKTTAQVEQSRLGLACAGSQWLIRLAD |
| WSSedB2BaDRAFT_10211131 | 3300000312 | Wetland | MARTAKLDLRAFQQELATRLASKTAAQVESSRLGLSFGGGNWLIRLSDAGEVV |
| AP72_2010_repI_A001DRAFT_10018866 | 3300000893 | Forest Soil | MARAAKLDLRAFQQELATRLAAKTAAQVEQSRLGLACAGTQWLIRLA |
| Ga0031654_101327352 | 3300003861 | Freshwater Lake Sediment | MARPARIDLRSFQDELATRLAAKTAAQVESSRLGLACGGMRWLIRLGDAAEVIAVPP |
| Ga0055460_101444873 | 3300004011 | Natural And Restored Wetlands | MARAGKLDLRVFQQELATRLASKTAAQVASSRLGLAAAGQQW |
| Ga0055456_102955422 | 3300004014 | Natural And Restored Wetlands | MARAGKLDLRVFQQELAARLASKTSAQVASSRLGLAAAGQQWL |
| Ga0055499_100873871 | 3300004047 | Natural And Restored Wetlands | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLACAGERWLIRLADAAE |
| Ga0062590_1012579793 | 3300004157 | Soil | MARAQKLDLRLFQQELATRLASKTTAQVESSRLGFAGAGRQWLIRLSDAAE |
| Ga0066604_103851162 | 3300004241 | Freshwater | MARAGKLDLRSFQQELASRLSSKTAAQVESSRLGLSCAGEQWLIRLADAGEV |
| Ga0062382_100224431 | 3300004782 | Wetland Sediment | MARGAKLDLRSFQQELATRLASKTAAQVESSRLGLACGGEQWLIRLADAGEVI |
| Ga0066690_109605102 | 3300005177 | Soil | MARAAKLNLRAFQQELATRLAAKTAAQVEQSRLGIACADERWLIRL |
| Ga0066685_103490301 | 3300005180 | Soil | MARTAKLDLRAFQQELATRLAAKTAAQVEQSRLGIACAGTQWLIRLSDAGEVI |
| Ga0066678_101479694 | 3300005181 | Soil | MARAAKLNLRAFQQELATRLAAKTAAQVEQSRLGIACADERWLIRLADAGE |
| Ga0066678_106814051 | 3300005181 | Soil | MARTAKLDLRAFQQELATRLAAKTAAQVEQSRLGIACAGTQWLIRLSDAGEV |
| Ga0066671_108524881 | 3300005184 | Soil | MARAGKLNLRAFQQELATRLAAKTTAQVEQSRLGLACAGSQWLIRLADAGEVIA |
| Ga0066676_110137922 | 3300005186 | Soil | MARARLNLRAFQQELSTRLAAKTAAQVEQSRLGIQCAGGQW |
| Ga0066675_100846034 | 3300005187 | Soil | MARAAKLNLRAFQQELATRLAAKTAAQVEQSRLGIACADE |
| Ga0065712_106352231 | 3300005290 | Miscanthus Rhizosphere | MTRAARLDLRSFQQELATRLAAKTTAQVESSRLGIECRGERW |
| Ga0070666_101336511 | 3300005335 | Switchgrass Rhizosphere | MARAARIDLRTFQQELASRLATKTAAQVESSRLGLSSGGSRWLIRLAEAGEVIT |
| Ga0070687_1004581341 | 3300005343 | Switchgrass Rhizosphere | MARAAKLDLRTFQQQLTTRLASKTAAQVESSRLGLACGGERFLIRLGDAAEVVAVPPIA |
| Ga0070687_1004890583 | 3300005343 | Switchgrass Rhizosphere | MARPARIDLQSFQQELANRLASKTAAQVESSRLGLACGGERFLIRLGDAAEVVAVPPIA |
| Ga0070687_1005332243 | 3300005343 | Switchgrass Rhizosphere | MARAAKLDLRAFQQELAARLAAKTTQQVEQSRLGLACAGKQWLIRLADAGEVIA |
| Ga0070668_1022093471 | 3300005347 | Switchgrass Rhizosphere | MARAAKLDLRTFQQELAARLASKTAAQVESSRLGLSSGGDQWLVRLGDAGEVVALPQVTA |
| Ga0070669_1009772653 | 3300005353 | Switchgrass Rhizosphere | MARPARIDLRLFQQELATRLASKTTAQVQSSRLGLSCGGERWLVRLAD |
| Ga0070675_1015567421 | 3300005354 | Miscanthus Rhizosphere | MTRAARLDLRSFQQELAARFANKTAAQVELSRLGLAGAGQQWLIRLSDASEVIAMPQVA |
| Ga0070674_1003594491 | 3300005356 | Miscanthus Rhizosphere | MTRAARLDLRSFQQELATRLAAKTTAQVESSRLGIECRGERWLVRLSDADEVIAVPPIVPVPL |
| Ga0070667_1010443001 | 3300005367 | Switchgrass Rhizosphere | MARAGKVDLRVFQQELAARLASKTTAQVESSRLGLASAGRQWLVRLADAGEVIATP |
| Ga0070713_1000240127 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRAARLDLRSFQQELATRLASKTAAQVESSRLGLACGDTRWL |
| Ga0070711_1006817943 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAKLDLRTFQQELTTRLAAKTAAQVESSRLGVSCADAR |
| Ga0070700_1013311111 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VARAAKLDLRAFQRELASRLATKTAAQVESSRLGLSCGGDRWLM |
| Ga0070708_1003928113 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MARTAKLDLRAFQQELATRLAAKTSAQVEQSRLGIACAGTQWLIRLSDAGE |
| Ga0066682_106530872 | 3300005450 | Soil | MARTAKLDLRAFQQELATRLAAKTAAQVEQSRLGIACAGTQWLI |
| Ga0070663_1019133512 | 3300005455 | Corn Rhizosphere | MTRAARLDLRSFQQELANRLAAKTTAQVESSRLGIECRGERWLVRLSDADEV |
| Ga0070681_116366622 | 3300005458 | Corn Rhizosphere | MARAPKAKLDLRTFQQELSTRLAAKTAAQVESSRLGLSCAG |
| Ga0070698_1021962141 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAKLNLRAFQQELATRLAAKTTAQVEQSRLGIACADERWLIRLA |
| Ga0074210_1134691 | 3300005481 | Sediment | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLIRLA |
| Ga0074211_1124031 | 3300005487 | Sediment | MARPARIDLRSFQDELATRLAAKTAAQVESSRLGLACGGMHWLIRLGTPPR* |
| Ga0070679_1000904445 | 3300005530 | Corn Rhizosphere | MSRAARLDLRSFQKELASRLASKTAAQVESSRLGVACGDKRWLIRLAEAGEVIA |
| Ga0070672_1020543172 | 3300005543 | Miscanthus Rhizosphere | MARAAKLDLRTFQQELSARLLMKTTAQVESSRLGLSCGGDRWLIRLADAGEVVNL |
| Ga0070686_1019170651 | 3300005544 | Switchgrass Rhizosphere | MARAAKLDLRAFQQELASRLATKTAAQVESSRLGLACGGDRWLM |
| Ga0070693_1001516711 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRAARLDLRSFQQELATRLAAKTTAQVESSRLGIECRGERWLVRLSDANEVIAVPPIV |
| Ga0070693_1006239851 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAKLDLRTFQQELAARLATKTTAQVESSRLGLASGGERWLVRLA |
| Ga0070693_1014815862 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRAARLDLRSFQQELATRLAAKTTAQVESSRLGIECLGERWLVRLFDAGEVIAVPPI |
| Ga0066707_108991982 | 3300005556 | Soil | MARARLNLRAFQQELSTRLAAKTAAQVEQSRLGIQCAG |
| Ga0068855_1004698281 | 3300005563 | Corn Rhizosphere | MARAPKAKLDLRTFQQELSTRLAAKTAAQVESSRLGLSC |
| Ga0068857_1024382032 | 3300005577 | Corn Rhizosphere | MARAAKLDLRAFQQELAARLAAKTTQQVEQSRLGLACAGKQWLIRLADAGEV |
| Ga0066706_106211993 | 3300005598 | Soil | MARAGKLNLRAFQQELATRLAAKTTAQVEQSRLGLACAGSQWLIRLADAGEVIAVPTVA |
| Ga0068852_1014812442 | 3300005616 | Corn Rhizosphere | MARAAKLDLRTFQQELTTRLAAKTAAQVESSRLGVSCAG |
| Ga0068852_1020791241 | 3300005616 | Corn Rhizosphere | MTRAARLDLRSFQQELTTRLAAKTTAQVESSRLGIECHGERWLV |
| Ga0068864_1021549772 | 3300005618 | Switchgrass Rhizosphere | MSRPARLDLRSFQQELATRLAAKTAAQVESSRLGLSCG |
| Ga0068864_1022891652 | 3300005618 | Switchgrass Rhizosphere | MARAAKLDLRAFQRELASRLASKTAAQVESSRLGLACGGEQWLIRLADAG |
| Ga0074472_104883911 | 3300005833 | Sediment (Intertidal) | MARTAKLDLRSFQKELASRLATKTAAQVESSRLGLACAGTQWLIRLADAGE |
| Ga0068863_1004122721 | 3300005841 | Switchgrass Rhizosphere | MARAAKLDLRTFQQELAARLASKTAAQVESSRLGLSSGGDQWLVRLGDAGEVVA |
| Ga0073920_10200231 | 3300005956 | Sand | MARTAKLDLRAFQQELATRLASKTAAQVESSRLGLSFGGGNWLIRLSDAGEV |
| Ga0066696_105543281 | 3300006032 | Soil | MARTAKLDLRAFQQELATRLAAKTAAQVEQSRLGIA |
| Ga0066652_1016481742 | 3300006046 | Soil | MARPARIDLRTFQQELAARLATKTAAQVESSRLGLLCAGTRWLVRLADAGE |
| Ga0075028_1000681541 | 3300006050 | Watersheds | MARAAKVDLRSFQQELASRLATKTAAQVESSRLGLACGGTQWLIRLA |
| Ga0075028_1005421891 | 3300006050 | Watersheds | MARAAKLDLRAFQQELATRLAAKTTAQVEQSRLGLACAGVQWLI |
| Ga0079037_1026179902 | 3300006224 | Freshwater Wetlands | MARAAKLDLRTFQQELATRLASKTAAQVESSRLGLSCGGENWLVR |
| Ga0097621_1013325521 | 3300006237 | Miscanthus Rhizosphere | MARAAKLDLRTFQQELAARLATKTTAQVESSRLGLASGGERW |
| Ga0068871_1009191373 | 3300006358 | Miscanthus Rhizosphere | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWL |
| Ga0068871_1013942302 | 3300006358 | Miscanthus Rhizosphere | MTRAARLDLRSFQQELAARLAAKTTAQVESSRLGIECHGERWLVRLFDAGEVIAVP |
| Ga0075521_100321944 | 3300006642 | Arctic Peat Soil | MARAAKLDLRTFQQELASRLATKTAAQVESSRLGLSSGGERW |
| Ga0079222_100090581 | 3300006755 | Agricultural Soil | MSRTARLDLRSFQQELATRLASKTAAQVESSRLGLACGSTRWLVRLADAGEVIAVPTII |
| Ga0079222_115416351 | 3300006755 | Agricultural Soil | MARAAKLDLRAFQQELAARLASKTTQQVEQSRLGLACAGRQWL |
| Ga0066659_118950902 | 3300006797 | Soil | MARAAKLDLRAFQQELATRLAAKTAAQVEQSRLGLA |
| Ga0066660_106147643 | 3300006800 | Soil | MARAAKLNLRAFQQELATRLAAKTAAQVEQSRLGIACADERWLI |
| Ga0079220_112296072 | 3300006806 | Agricultural Soil | MSRAAKLDLRVFQQELATRLASKTAAQVESSRLGLSCAGENWLIRLADASEVIAVPSIASVPL |
| Ga0075430_1015109222 | 3300006846 | Populus Rhizosphere | MARAPRIDLRTFQQELASRLATKTAAQVESSRLGLSSGGERWLVRLA |
| Ga0079219_100708601 | 3300006954 | Agricultural Soil | MTRPGRIDLQSFQQELANRLASKTAAQVESSRLGLACGGERFLIRL |
| Ga0079219_102102163 | 3300006954 | Agricultural Soil | MSRAARLDLRSFQKELASRLASKTAAQVESSRLGIACGD |
| Ga0075435_1002198734 | 3300007076 | Populus Rhizosphere | MPRAAKLNLRAFQQELATRLAAKTAAQVEQSRLGIACAGEQWLI |
| Ga0075435_1004033381 | 3300007076 | Populus Rhizosphere | MTRAARLDLRSFQQELATRLAAKTTAQVESSRLGIECRGERWLVRLS |
| Ga0066710_1033362171 | 3300009012 | Grasslands Soil | MARAGKLDLRAFQQQLASRLAAKTTAQVEQSRLGLACAGAQWLIRLAYAGEEIADPSMDR |
| Ga0099827_102895904 | 3300009090 | Vadose Zone Soil | MARAAKLDLRAFQRELATRLAAKTSAQVEQSRLGIACAGTQWPIRLSDAGEVIAV |
| Ga0105245_105239481 | 3300009098 | Miscanthus Rhizosphere | MARAAKLDLRTFQQELAARLATKTTAQVESSRLGLASGGERWLVRLADAGEVTT |
| Ga0105245_114032953 | 3300009098 | Miscanthus Rhizosphere | MARAAKLDLRTFQQELSARLLMKTTAQVESSRLGLSCGGDRWLIRL |
| Ga0115026_116752112 | 3300009111 | Wetland | MARAAKLDLRTFQQELATRLASKTAAQVESSRLGLSCGGENWLVRLAD |
| Ga0115027_110461232 | 3300009131 | Wetland | MARAAKLDLRVFQQELAARLANTSEAEVDSTRLGLVCGGGQWLTRLADAAEVV |
| Ga0105243_107381501 | 3300009148 | Miscanthus Rhizosphere | MARAAKLDLRTFQQELTTRLASKTAAQVESSRLGLSCGGERW |
| Ga0111538_117819011 | 3300009156 | Populus Rhizosphere | MARAAKLDLRTFQRELASRLLTKTAAQVESSRLGLSCGGDRWLMRL |
| Ga0075423_117236731 | 3300009162 | Populus Rhizosphere | MARAAKLDLRTFQQELASRLATKTAAQVESSRLGLAAGGDRWLIRLADAGEVVTMP |
| Ga0075423_122881262 | 3300009162 | Populus Rhizosphere | MARAARIDLRTFQQELATRLAAKTAAQVESSRLGLLCGGTRW |
| Ga0113563_111559101 | 3300009167 | Freshwater Wetlands | MPRPARIDLRLFQQELATRLASKTTAQVQSSRLGLSCAGERWLIRLADAAEVVAVPPLA |
| Ga0113563_115469571 | 3300009167 | Freshwater Wetlands | MARAAKLDLRTFQQELATRLASKTAAQVESSRLGLASGGENWL |
| Ga0105241_105555233 | 3300009174 | Corn Rhizosphere | MSRTARLDLRSFQQELATRLASKTAAQVESSRLGLACGSNRWLV |
| Ga0105241_110025221 | 3300009174 | Corn Rhizosphere | MARAAKLDLRAFQQELAARLAAKTTQQVEQSRLGLACAGKQWLIRLADAGEVV |
| Ga0105241_115899322 | 3300009174 | Corn Rhizosphere | MSRAARLDLRSFQQELATRLASKTAAQVESSRLALACGDTRWLIRLAD |
| Ga0115028_114759332 | 3300009179 | Wetland | MPRPARIDLRLFQQELATRLASKTTAQVQSSRLGLSCAGERWLIRLADAA |
| Ga0105237_116712871 | 3300009545 | Corn Rhizosphere | MSRAARLDLRSLQKELASRLASKTAAQVESSRLGIACGARRWLI |
| Ga0105238_111485193 | 3300009551 | Corn Rhizosphere | MSRAARLDLRSFQQELANRLASKTAAQVESSRLGIACGEARWLIRLA |
| Ga0116147_12787291 | 3300009667 | Anaerobic Digestor Sludge | MARTAKLDLRAFQQELATRLASKTAAQVESSRLGLA |
| Ga0116153_101338261 | 3300009838 | Anaerobic Digestor Sludge | MARTAKLDLRSFQQELATRLASKTAAQVESSRLGLACGGDQWL |
| Ga0126313_115936032 | 3300009840 | Serpentine Soil | MARAQKLDLRLFQQELAARLASKTVAEVESSRLGLAGAGQQWLVLLSDAAEVIAMPTIA |
| Ga0074044_107304062 | 3300010343 | Bog Forest Soil | MARTAKLDLRAFQQELATRLAAKTAAQVEQSRLGLACGGEQWLIR |
| Ga0134066_103114471 | 3300010364 | Grasslands Soil | MARAARIDLRTFQQELASRLAAKTAAQVESSRLGLLCAGTRWLIKLADAGE |
| Ga0126379_108867881 | 3300010366 | Tropical Forest Soil | MARAARLDLRSFQQELAARLATKTAAQVEQSRLGLSCAGERWLIR |
| Ga0126379_108947471 | 3300010366 | Tropical Forest Soil | MPRAARLDLRAFQQELATRLAAKTAAQVEQSRLSVAC |
| Ga0126379_118601303 | 3300010366 | Tropical Forest Soil | MARAAKLDLRAFQRELATRLAAKTAAQVEQSRLGV |
| Ga0126379_129382392 | 3300010366 | Tropical Forest Soil | MVRPARIDLQSFQQELANRLAAKTAAQVESSRLGLACGGER |
| Ga0134126_114405051 | 3300010396 | Terrestrial Soil | MSRAARLDLRSFQRELASRLASKTAAQVESSRLGVASANGMWLIRLPDASEVIAVPPI |
| Ga0134124_108872693 | 3300010397 | Terrestrial Soil | MSRAARVDLRSFQQELATRLAAKTAAQVESSRLGLASGSERWLIRLADAG |
| Ga0126383_117148352 | 3300010398 | Tropical Forest Soil | MARAAKLDLRSFQQELASRLVTKTAAQVESSRLGLAWAARNG* |
| Ga0126383_123703241 | 3300010398 | Tropical Forest Soil | MVRPARIDLQSFQQELANRLAAKTAAQVESSRLGLACGGERFLIRLGDAAEVVAVPPIA |
| Ga0134122_127493963 | 3300010400 | Terrestrial Soil | MSRAARVDLRSFQQELATRLAAKTAAQVESSRLGLASGSE |
| Ga0134121_122711091 | 3300010401 | Terrestrial Soil | MARAAKLDLRTFQQELAARLATKTTAQVESSRLGLASGGE |
| Ga0137392_101851964 | 3300011269 | Vadose Zone Soil | MARAGKLNLRAFQQELATRLAAKTTAQVEQSRLGLACAG |
| Ga0137392_114474041 | 3300011269 | Vadose Zone Soil | MARAAKLNLRAFQQELATRLAAKTTAQVEQSRLGIACADERWLIRL |
| Ga0137427_100334391 | 3300011445 | Soil | MARAPRIDLRTFQQELASRLATKTAAQVESSRLGLSSGGER |
| Ga0136636_102513371 | 3300012044 | Polar Desert Sand | MARAAKLDLRTFQKELASRLATKTAAQVESSRLGMA |
| Ga0136634_105035632 | 3300012046 | Polar Desert Sand | MARAAKLDLRTFQKELASRLATKTAAQVESSRLGMASGGERWLIRLSDA |
| Ga0137388_106792491 | 3300012189 | Vadose Zone Soil | MARAAKLNLRAFQQELATRLAAKTTAQVEQSRLGIACADERWLIRLADAGE |
| Ga0137364_105465611 | 3300012198 | Vadose Zone Soil | MSTMVRPARIDLRTFQQELASRLATKTAAQVESSRLGLLCAGTRWLVRLADAGEVVALPHIVTV |
| Ga0137378_102013211 | 3300012210 | Vadose Zone Soil | MARAAKLDLRAFQQELATRLAAKTAAQVEQSRLGLAC |
| Ga0137370_102078371 | 3300012285 | Vadose Zone Soil | MSTMVRPARIDLRTFQQELASRLATKTAAQVESSRL |
| Ga0150984_1178037771 | 3300012469 | Avena Fatua Rhizosphere | MARAARIDLRTFQQELASRLAAKTAAQVESSRLGLLCAGSRWLIKLADAGEVVALP |
| Ga0150984_1200031363 | 3300012469 | Avena Fatua Rhizosphere | MARAAKLDLRRFQQELAARLAAKTTAQVEQSRLGLACAGRQWLIRLAEPVTK |
| Ga0157334_10158461 | 3300012509 | Soil | MSRAARLDLRSFQQELATRLASKTAAQVESSRLALACGSTRWLVR |
| Ga0157332_10620072 | 3300012511 | Soil | MSRTARLDLRSFQQELATRLASKTAAQVESSRLGLACGSTRWL |
| Ga0137373_106374023 | 3300012532 | Vadose Zone Soil | FQQELATRLASKTAAQVESSRLGLATGGEQWLIRLAEAGEVITIPPLAVVPITSPNSCSSTS* |
| Ga0157293_100510063 | 3300012898 | Soil | MARAAKLDLRTFQQELAARLASKTAAQVESSRLGLSSGGDQWLVRLGDAGEVV |
| Ga0157295_103822762 | 3300012906 | Soil | MARAAKLDLRTFQQELAARLASKTAAQVESSRLGLSSGGDQWLVRL |
| Ga0157310_101924351 | 3300012916 | Soil | MSRAARLDLRSFQQELATRLAAKTAAQVESSRLGFSCGDERWLI |
| Ga0157310_103626611 | 3300012916 | Soil | MARAAKLDLRTFQQELAARLASKTAAQVESSRLGLSSGGDQWLVRLGDAGEVVTL |
| Ga0137416_108141421 | 3300012927 | Vadose Zone Soil | MARAAKLNLRAFQQELATRLAAKTTLQVEQSRLGIACADERWLIRLADAG |
| Ga0137407_114964301 | 3300012930 | Vadose Zone Soil | MARAAKLNLRAFQQELATRLAAKTAAQVEQSRLGIAC |
| Ga0164300_105647043 | 3300012951 | Soil | MARAAKLDLRAFQQELAARLAAKTTQQVEQSRLGLACAGKQWL |
| Ga0164298_105030203 | 3300012955 | Soil | MARAAKLDLRAFQQELAARLAAKTTQQVEQSRLGLACAGKQWLIRLADAGEVVA |
| Ga0164299_101110641 | 3300012958 | Soil | MARAAKLDLRAFQQELAARLAAKTTQQVEQSRLGLACAGRQ |
| Ga0164299_103726123 | 3300012958 | Soil | MSRAAKLDLRVFQQELATRLASKTAAQVESSRLGLCCAGENWLIRLADASEVIAVPSI |
| Ga0164299_106524211 | 3300012958 | Soil | MARAAKLDLRTFQQELTTRLASKTAAQVESSRLGLACGGERFLIRLGDAAEVVAVPPIA |
| Ga0126369_111300021 | 3300012971 | Tropical Forest Soil | MARAAKLDLRSFQQELASRLVTKTAAQVESSRLGLACGGTQW |
| Ga0126369_119065691 | 3300012971 | Tropical Forest Soil | MVRPARIDLQSFQQELANRLAAKTAAQVESSRLGLACGGERFLIRLGDAAEVVAVPPIAGVPL |
| Ga0126369_129429582 | 3300012971 | Tropical Forest Soil | MTTMVRPARIDLQTFQQELANRLASKTAAQVESSRLGLACGGERFLIRL |
| Ga0126369_135516651 | 3300012971 | Tropical Forest Soil | MARSARLDLRSFQQELASRLAAKTAAQVESSRLGIACGDERWL |
| Ga0157371_102861283 | 3300013102 | Corn Rhizosphere | MSRAARLDLRSFQKELASRLASKTAAQVESSRLGIACGARRWLIRLG |
| Ga0157370_106949121 | 3300013104 | Corn Rhizosphere | MSRAARLDLRSFQRELASRLASKTAAQVESSRLGV |
| Ga0157378_101960244 | 3300013297 | Miscanthus Rhizosphere | MTRPGRIDLQSFQQELATRLASKTTAQVQSSRLGLSCAGERWLVRLADAAE |
| Ga0163162_112754691 | 3300013306 | Switchgrass Rhizosphere | MSRTARVDLRSFQQELATRLAAKTAAQVESSRLGLASGNERWLIRLADAGEVIAVP |
| Ga0163162_126977091 | 3300013306 | Switchgrass Rhizosphere | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLIRLADAAEVVAVPPLAG |
| Ga0157372_117156121 | 3300013307 | Corn Rhizosphere | MARAAKLDLRAFQQELAARLAAKTTQQVEQSRLGLA |
| Ga0157372_122781741 | 3300013307 | Corn Rhizosphere | MSRAARLDLRSFQRELASRLASKTAAQVESSRLGVASANGMWLIRLPD |
| Ga0120127_100224753 | 3300013503 | Permafrost | MSRPARLDLRSFQQELASRLASKTAAQVESSRLGIACGDARWLIRLADAGEVI |
| Ga0120123_11717461 | 3300013770 | Permafrost | MSRATRLDLRSFQRELATRLASKTAAQVESSRLGLASKGG |
| Ga0075347_10314131 | 3300014313 | Natural And Restored Wetlands | VRNPFTDAMSRPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLIRLADA |
| Ga0157376_115438203 | 3300014969 | Miscanthus Rhizosphere | MARAGKLDLRKFQQELATRLASKTAAQVESSRLGLSCAGERWLIRLPDAS |
| Ga0167638_10314501 | 3300015197 | Glacier Forefield Soil | MARAAKLNLRAFQQELATRLAAKTTAQVEQSRLGLSCGGVQWLIRLA |
| Ga0132258_128568163 | 3300015371 | Arabidopsis Rhizosphere | MARAAKLDLRTFQQELAARLATKTTAQVESSRLGLASGGERWLVRLAD |
| Ga0132258_138629181 | 3300015371 | Arabidopsis Rhizosphere | MARAAKLDLRSFQQELASRLVTKTAAQVESSRLGLACGGTQWLIRLADA |
| Ga0132256_1004427674 | 3300015372 | Arabidopsis Rhizosphere | MARAAKLDLRSFQQELASRLATKTAAQVESSRLGLACGGAQWLIRLADA |
| Ga0132257_1001763394 | 3300015373 | Arabidopsis Rhizosphere | MPRAAKLDLRSFQQELASRLATKTAAQVESSRLGLSCGGVQWLIRLAD |
| Ga0132257_1040817511 | 3300015373 | Arabidopsis Rhizosphere | MARAAKLDLRSFQQELASRLATKTAAQVESSRLGLACGGSQWLIRLADAGEVITIP |
| Ga0132255_1004668441 | 3300015374 | Arabidopsis Rhizosphere | MARAAKLDLRAFQQELASRLAAKTSAQVEQSRLGLECAGGQWLIRLADAGEVIA |
| Ga0132255_1054922812 | 3300015374 | Arabidopsis Rhizosphere | MARPARIDLQSFQQELANRLASKTAAQVESSRLGLACGGERFLIRLGDAAEVVAV |
| Ga0182033_115273911 | 3300016319 | Soil | MARAARLDLRSFQQELAARLATKTAAQVEQSRLGLSCAGERWLIRLADAGEVIAVPD |
| Ga0182032_116832162 | 3300016357 | Soil | MTTMVRPARIDLQSFQQELANRLAAKTAAQVESSRLGLACGGERFLIRLGDAAEVVAV |
| Ga0163161_118848611 | 3300017792 | Switchgrass Rhizosphere | MTRPGRIDLQSFQQELANRLASKTAAQVESSRLGLACG |
| Ga0187825_102637542 | 3300017930 | Freshwater Sediment | MSRAARLDLRSFQKELASRLASKTAAQVESSRLGLACF |
| Ga0184605_100501581 | 3300018027 | Groundwater Sediment | MARAGKLNLRAFQQELATRLAAKTTAQVEQSRLGLA |
| Ga0187766_102518023 | 3300018058 | Tropical Peatland | MPRAARLDLRAFQQELASRLAAKTAAQVEQSRLGVACAGAQWLI |
| Ga0187766_109082141 | 3300018058 | Tropical Peatland | MARAAKLDLRAFQRELATRLAAKTAAQVEQSRLGIACAG |
| Ga0187766_112067272 | 3300018058 | Tropical Peatland | MARAAKLDLRTFQQELASRLATKTAAQVESSRLGL |
| Ga0184632_103507242 | 3300018075 | Groundwater Sediment | MSRAARLDLRTFQQELASRLATKTAAQVESSRLGLSANGMRWLIRLVDAGEVI |
| Ga0184625_105455631 | 3300018081 | Groundwater Sediment | MARAAKLDLRTFQQELSARLLTKTAAQVESSRLGLSCGGDRWLIRLTDAGEV |
| Ga0190272_116338991 | 3300018429 | Soil | MARAAKLDLRKFHQELATPLASKTAPQVEIARLRLS |
| Ga0190274_104406011 | 3300018476 | Soil | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCVGERWLIR |
| Ga0066669_115998651 | 3300018482 | Grasslands Soil | MARAARIDLRTFQQELASRLAAKTAAQVESSRLGLLCAGTRWLIKLADAGEVVALPHIVT |
| Ga0190273_120542682 | 3300018920 | Soil | MARPARIDLRVFQQELAARLASTTAARVESSRLGLACGGERWLIRLAD |
| Ga0193723_11156113 | 3300019879 | Soil | MARPARIDLRTFQQELAARLATKTAAQVESSRLGLLCAGTRWLVRLADAGEVVTLPHIVSVPMTRQ |
| Ga0193725_11248041 | 3300019883 | Soil | MARAGKLNLRAFQQELATRLAAKTTAQVEQSRLGLACAGSQWLIRLADAGEVIAVPTVAT |
| Ga0193728_11911933 | 3300019890 | Soil | MARAGKLNLRAFQQELATRLAAKTTAQVEQSRLGLACAGS |
| Ga0193755_10481344 | 3300020004 | Soil | MARAGRLDLRTFQKELASRLATKTAAQVESSRLGLSCG |
| Ga0193745_11195051 | 3300020059 | Soil | MARPARIDLQSFQQELANRLASKTAAQVESSRLGFACGGERFLIRLADAAEVVAVPP |
| Ga0193719_101060661 | 3300021344 | Soil | MARAGKLNLRAFQQELATRLAAKTTAQVEQSRLGLACAGSQ |
| Ga0210384_111848213 | 3300021432 | Soil | MARAAKLDLRAFQQELATRLAAKTTAQVEQSRLGLACADEQWLIRLA |
| Ga0182009_100255351 | 3300021445 | Soil | MSRAAKLDLRVFQQELATRLASKTAAQVESSRLGLSCAG |
| Ga0182009_100498751 | 3300021445 | Soil | MARAAKLDLRTFQQELTTRLASKTAAQVESSRLGLSCGGERWL |
| Ga0210402_102555204 | 3300021478 | Soil | MARAAKLDLRAFQQELATRLAAKTAAQVEQSRLGIACAG |
| (restricted) Ga0224722_10265971 | 3300021518 | Freshwater Sediment | VARAAKLDLRSFQQELASRLATKTAAQVESSRLGLSCGGDRWLVRLADAGEVVAM |
| Ga0224505_101489463 | 3300022214 | Sediment | MSRPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAG |
| Ga0224452_12511102 | 3300022534 | Groundwater Sediment | MARPARIDLQSFQQELANRLASKTAAQVESSRLGLACGGERFLIRLGD |
| Ga0222622_102466911 | 3300022756 | Groundwater Sediment | MARPARIDLRTFQQELASRLATKTAAQVESSRLGLSSGG |
| Ga0222622_113650912 | 3300022756 | Groundwater Sediment | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLI |
| Ga0247792_11486081 | 3300022880 | Soil | MTRAARLDLRSFQQELATRLAAKTTAQVESSRLGIECRGERWLVRLSDANE |
| Ga0247788_10498833 | 3300022901 | Soil | MARAAKLDLRTFQQELSARLLTKTAAQVESSRLGLSCGGDR |
| Ga0247801_10945011 | 3300023064 | Soil | MARPARIDLRLFQQELATRLASKTTAQVQSSRLGLSCGGER |
| Ga0207697_102475471 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAKLDLRTFQQELSARLLMKTTAQVESSRLGLSCGGD |
| Ga0207656_101124184 | 3300025321 | Corn Rhizosphere | MTRAARLDLRSFQQELATRLAAKTTAQVESSRLGIECHGERW |
| Ga0208851_10556562 | 3300025461 | Arctic Peat Soil | MARAAKLDLRTFQQELASRLATKTVAQVESSRLGLSSGGERWLIRL |
| Ga0207685_107776151 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAGKLDLRKFQQELATRLASKTAAQVESSRLGLS |
| Ga0207699_102187304 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRAARLDLRSFQKELASRLASKTAAQVESSRLGVACGDKRWLIRLAEAGEVIAVPPIV |
| Ga0207645_100465861 | 3300025907 | Miscanthus Rhizosphere | MTRPGRIDLQSFQQELANRLASKTAAQVESSRLGLACGGER |
| Ga0207643_108044292 | 3300025908 | Miscanthus Rhizosphere | VARAAKLDLRSFQRELASRLATKTAAQVESSRLGLSCGGDRWLMRLA |
| Ga0207654_105612111 | 3300025911 | Corn Rhizosphere | MSRAARLDLRSFQKELASRLASKTAAQVESSRLGVACGDKRWLIRLAEAGEVIF |
| Ga0207707_100137351 | 3300025912 | Corn Rhizosphere | MARAAKLDLRSFQQELATRLASKTAAQVESSRLSFACGAEQWLI |
| Ga0207671_107952793 | 3300025914 | Corn Rhizosphere | MARAAKLDLRAFQQELAARLAAKTTQQVEQSRLGLACAGMQWLIRLADAGE |
| Ga0207693_105984733 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAGKLNLRAFQQELATRLAAKTTAQVEQSRLGLAC |
| Ga0207663_104127191 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAKLDLRAFQQELATRLAAKTSAQVEQSRLGLECAGGQWLIRLADAGEVIAV |
| Ga0207663_107242853 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAGKLNLRAFQQELATRLAAKTTAQVEQSRLGLACAGSQWLIRLADA |
| Ga0207660_104736261 | 3300025917 | Corn Rhizosphere | MSRAARLDLRSFQRELASRLASKTAAQVESSRLGVASANGMWLIRLPDASEVIAVP |
| Ga0207660_113812092 | 3300025917 | Corn Rhizosphere | MSRAARLDLRSFQQELATRLAAKTAAQVESSRLGFSCG |
| Ga0207652_105543963 | 3300025921 | Corn Rhizosphere | MARAGKLDLRTFQRELTTRLASKTAAQVQSSRLGLEAAGGRWLIRLADAGEVIAMPSV |
| Ga0207681_106296303 | 3300025923 | Switchgrass Rhizosphere | MARPARIDLRLFQQELATRLASKTTAQVESSRLGMSCVGE |
| Ga0207650_102766331 | 3300025925 | Switchgrass Rhizosphere | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLLRL |
| Ga0207687_111020041 | 3300025927 | Miscanthus Rhizosphere | MARAPRVDLRTFQQELATRLATKTTAQVESSRLGL |
| Ga0207701_110264431 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLLRLADAAEV |
| Ga0207701_114866302 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAKLDLRTFQQELSARLLMKTTAQVESSRLGLSC |
| Ga0207644_105630003 | 3300025931 | Switchgrass Rhizosphere | MARAAKLDLRTFQQELSARLLMKTTAQVESSRLGLSCGGDRW |
| Ga0207644_113606692 | 3300025931 | Switchgrass Rhizosphere | MARPARIDLRLFQQELATRLASKTTAQVESSRLGMSCVGER |
| Ga0207686_116760821 | 3300025934 | Miscanthus Rhizosphere | MARAAKLDLRTFQQELAARLATKTTAQVESSRLGLASGGERWLVRLADAGEV |
| Ga0207670_118350042 | 3300025936 | Switchgrass Rhizosphere | MARAAKLDLRTFQQELAARLASKTAAQVESSRLGLSSGGD |
| Ga0207704_111934992 | 3300025938 | Miscanthus Rhizosphere | MARAAKLDLRTFQQELSARLLMKTTAQVESSRLGLSCGGDR |
| Ga0207691_106164743 | 3300025940 | Miscanthus Rhizosphere | MARAAKLDLRTFQRELASRLLTKTAAQVESSRLGLSCGGDR |
| Ga0207691_106495341 | 3300025940 | Miscanthus Rhizosphere | MSRPARLDLRSFQQELATRLAAKTAAQVESSRLGLSCGDERWLIRLADAG |
| Ga0207691_112066103 | 3300025940 | Miscanthus Rhizosphere | MARAPRVDLRTFQQELATRLATKTTAQVESSRLGLSTGNE |
| Ga0207711_100135111 | 3300025941 | Switchgrass Rhizosphere | MARAAKLDLRTFQQELSARLLMKTTAQVESSRLGLSCGGDRWLIRLADAGEVV |
| Ga0207711_104633133 | 3300025941 | Switchgrass Rhizosphere | MTRAARLDLRSFQQELATRLAAKTTAQVESSRLGIECRGERWLVRLSD |
| Ga0207689_115696961 | 3300025942 | Miscanthus Rhizosphere | MTRPGRIDLQSFQQELANRLASKTAAQVESSRLGLACGGERFLIRLGDAAEVVAVPPIAKVP |
| Ga0207661_115610942 | 3300025944 | Corn Rhizosphere | MSRAARLDLRSFQQELTNRLASKTTAQVESSRLGVACFDR |
| Ga0207679_106771793 | 3300025945 | Corn Rhizosphere | MSRAARLDLRSFQQELATRLAAKTAAQVESSRLGFSCGD |
| Ga0207679_114786991 | 3300025945 | Corn Rhizosphere | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLLRLADAAEVVAVP |
| Ga0207640_101821764 | 3300025981 | Corn Rhizosphere | MARAAKLDLRTFQQELSARLLMKTTAQVESSRLGLSCGGDRWLIRLADA |
| Ga0207640_118240592 | 3300025981 | Corn Rhizosphere | MSRAARLDLRSFQQELTNRLASKTTAQVESSRLGVACFD |
| Ga0207658_105494901 | 3300025986 | Switchgrass Rhizosphere | MSRPARLDLRSFQQELATRLAAKTAAQVESSRLGLSCGD |
| Ga0207658_108342611 | 3300025986 | Switchgrass Rhizosphere | MARAAKLDLRTFQQELAKRLATKTAAQVESSRLGLACGDDRWLIRL |
| Ga0207639_103402791 | 3300026041 | Corn Rhizosphere | MTRAARLDLRSFQQELANRLAAKTTAQVESSRLGIECRGERWLVRLSDA |
| Ga0207639_122378661 | 3300026041 | Corn Rhizosphere | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLLRLADA |
| Ga0208421_10214892 | 3300026058 | Natural And Restored Wetlands | MSRAARLDLRSFQQELASRLASKTAAQVESSRLGLACGERRFLIRLSDAGE |
| Ga0207678_112989932 | 3300026067 | Corn Rhizosphere | MARAAKLDLRAFQQELAARLAAKTTQQVEQSRLGLACAGKQWLIRLAD |
| Ga0208539_10095461 | 3300026069 | Natural And Restored Wetlands | MSRPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGE |
| Ga0207702_125022912 | 3300026078 | Corn Rhizosphere | MSRAAKLDLRVFQQELATRLASKTAAQVESSRLGLSCAGENWLIRLADASEV |
| Ga0207641_119918962 | 3300026088 | Switchgrass Rhizosphere | MARAAKLDLRTFQQELASRLATKTTAQVESSRLGMSCGGDRWLIRLADAGEVVT |
| Ga0207676_108131721 | 3300026095 | Switchgrass Rhizosphere | MTRAARLDLRSFQQELANRLAAKTTAQVESSRLGIECRGERWLVRLSDADEVIAVP |
| Ga0207698_104546121 | 3300026142 | Corn Rhizosphere | MSRAARLDLRSFQKELATRLASKTAAQVESSRLCIACGERRFLIRLGEAGEVIALPPI |
| Ga0207698_113977701 | 3300026142 | Corn Rhizosphere | MARAAKLDLRTFQQELTTRLAAKTAAQVESSRLGVSCAGER |
| Ga0207698_117701082 | 3300026142 | Corn Rhizosphere | MSRAARLDLRSFQQELATRLASKTAAQVESSRLGLACGDTRWLIRLADAGEV |
| Ga0209849_10595191 | 3300026215 | Soil | MARAAKLNLRAFQQELATRLAAKTTAQVEQSRLGLSC |
| Ga0209055_12936931 | 3300026309 | Soil | MARAAKLNLRAFQQELATRLAAKTAAQVEQSRLGIACADERWLIRLA |
| Ga0257146_10647702 | 3300026374 | Soil | MARTAKLDLRAFQQELATRLAAKTSAQVEQSRLGIACAGTQWLIRLSDAGEVIAVPQ |
| Ga0209806_11972071 | 3300026529 | Soil | MARAGKLNLRAFQQELATRLAAKTTAQVEQSRLGLACA |
| Ga0209523_11144161 | 3300027548 | Forest Soil | MARTAKLDLRAFQQELATRLAAKTAAQVEQSRLGVACGGEHWL |
| Ga0209971_10405561 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MSRAARLDLRSFQQELATRLAAKTAAQVESSRLGFSCGDE |
| Ga0209773_101689413 | 3300027829 | Bog Forest Soil | MARAAKLDLRAFQRELATRLAAKTTAQVEQSRLGLACAGDQWLIRLADAGEVIA |
| Ga0209797_102175553 | 3300027831 | Wetland Sediment | MARAARIDLQSFQQELATRLASKTAAQVESSRLGFACAGEQWLIR |
| Ga0209683_100390994 | 3300027840 | Wetland Sediment | MARGAKLDLRSFQQELATRLASKTAAQVESSRLGLACGGEQWLIRLADAGEVIAVPPV |
| Ga0209450_100630734 | 3300027885 | Freshwater Lake Sediment | MARAAKLDLRTFQQELAARLASKTAAQVESSRLGLSCGGEN |
| Ga0208980_103276281 | 3300027887 | Wetland | MARAAKLDLRVFQQELAARLANTSDAEVDSTRLGL |
| Ga0209254_107907662 | 3300027897 | Freshwater Lake Sediment | MARAGKLDLRSFQKELASRLSSKTSAQVESSRLGLSCAGEQWLIRLADAGE |
| Ga0209253_106378181 | 3300027900 | Freshwater Lake Sediment | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGEQWL |
| Ga0268266_101859354 | 3300028379 | Switchgrass Rhizosphere | MTRAARLDLRSFQQELATRLAAKTTAQVESSRLGIECRGERWLVRLSDAD |
| Ga0268266_109299363 | 3300028379 | Switchgrass Rhizosphere | MARAPRVDLRTFQQELATRLATKTTAQVESSRLGLSTGTERWLVRLA |
| Ga0268264_103493133 | 3300028381 | Switchgrass Rhizosphere | MARAAKLDLRAFQQELAARLAAKTTQQVEQSRLGLACAGKQWLI |
| Ga0268264_112056163 | 3300028381 | Switchgrass Rhizosphere | MSRAARVDLRSFQQELATRLAAKTAAQVESSRLGLASGNER |
| Ga0268264_121469432 | 3300028381 | Switchgrass Rhizosphere | MARAAKLDLRAFQRELASRLASKTAAQVESSRLGLACGGEQWLIRL |
| Ga0247828_100475581 | 3300028587 | Soil | MSRPARLDLRSFQQELATRLAAKTAAQVESSRLGLSCGDERWL |
| Ga0247818_107018753 | 3300028589 | Soil | MARAAKLDLRTFQQELAARLASKTAAQVESSRLGLACGGDQW |
| Ga0247823_105105403 | 3300028590 | Soil | MARAAKLDLRTFQQELAARLASKTAAQVESSRLGLACGGDQWLVRLG |
| Ga0247821_102032483 | 3300028596 | Soil | MSRAARLDLRSFQQELATRLAAKTAAQVESSRLGFS |
| Ga0302166_100802923 | 3300028652 | Fen | MARAAKVDLRSFQQELASRLATKTAAQVESSRLGLACGG |
| Ga0302166_101296512 | 3300028652 | Fen | MARPAKLDLRTFQQELAARLATKTTAQVESSRLGLA |
| Ga0302169_101018103 | 3300028679 | Fen | MARAAKLDLRTFQQELASRLATKTTAQVESSRLGLASGGE |
| Ga0268298_102177383 | 3300028804 | Activated Sludge | MARTAKLDLRAFQQELATRLASKTAAQVESSRLGLAC |
| Ga0247824_109251341 | 3300028809 | Soil | MTRAARLDLRSFQQELATRLAAKTTAQVESSRLGIECRGERWLVRLSDADEVIAVPPIVP |
| Ga0302259_11781252 | 3300028861 | Fen | MARAAKVDLRSFQQELASRLATKTAAQVESSRLGLACGGAQWLIR |
| Ga0302254_102873182 | 3300028870 | Fen | MARTAKLDLRTFQQELAARLATKTTAQVESSRLGLASGGERWLVR |
| Ga0311347_103291111 | 3300029923 | Fen | MARTAKLDLRTFQQELAARLATKTTAQVESSRLGLASGGERWLVRLADAGEVTTL |
| Ga0311332_112207891 | 3300029984 | Fen | MARAAKLDLRAFQQELATRLAAKTSAQVEQSRLGLACAGAQWLIRLADAGEVIAIP |
| Ga0311365_116000651 | 3300029989 | Fen | MARAAKLDLRAFQQELAARLAAKTTAQVEQSRLGLAAAGSQWLIRLAD |
| Ga0311336_100904261 | 3300029990 | Fen | MARAAKVDLRSFQQELASRLATKTAAQVESSRLGLACGGAQWLIRLADAGEV |
| Ga0311336_107221483 | 3300029990 | Fen | MARAAKLDLRAFQQELATRLAAKTSAQVEQSRLGLACAGAQWLI |
| Ga0311337_101393134 | 3300030000 | Fen | MARTAKLDLRTFQQELASRLATKTTAQVESSRLGLA |
| Ga0311337_119355871 | 3300030000 | Fen | MARTARIDLRSFQHELATRLASKTAAQVESSRLGLA |
| Ga0311350_100146291 | 3300030002 | Fen | MARTAKLDLRTFQQELAARLATKTTAQVESSRLGLASG |
| Ga0311350_111684962 | 3300030002 | Fen | MARPAKLDLRTFQQELAARLATKTTAQVESSRLGLASGGERWLVRLADAGEVTTLPV |
| Ga0311350_119413622 | 3300030002 | Fen | MARTAKLDLRSFQKELATRLASKTAAQVESSRLGLDCGGEQWLIRLADA |
| Ga0302286_104621782 | 3300030047 | Fen | MARAAKLDLRTFQQELASRLATKTTAQVESSRLGLSSGGERWLVRLADA |
| Ga0302217_101203741 | 3300030052 | Fen | MARAAKVDLRSFQQELASRLATKTAAQVESSRLGLACG |
| Ga0311349_102768654 | 3300030294 | Fen | MARAAKLDLRTFQQELSARLLTKTAAQVESSRLGLS |
| Ga0311349_109858203 | 3300030294 | Fen | MARVAKVDLRSFQQELASRLATKTAAQVESSRLGLACGGAQWLIR |
| Ga0311349_114542581 | 3300030294 | Fen | MARAAKLDLRTFQQELASRLATKTTAQVESSRLGLASGG |
| Ga0311360_112304021 | 3300030339 | Bog | MARAAKLDLRTFQQELASRLATKTTAQVESSRLGLA |
| Ga0311335_108584713 | 3300030838 | Fen | MARTAKLDLRTFQQELASRLATKTTAQVESSRLGLASGGE |
| Ga0311366_115456851 | 3300030943 | Fen | MARAAKLDLRTFQQELASRLATKTTAQVESSRLGLASGGERWLVR |
| Ga0307498_101210873 | 3300031170 | Soil | MARAAKLDLRAFQQELASRLAAKTSAQVEQSRLGLECAG |
| Ga0307495_102346082 | 3300031199 | Soil | MARAAKLDLRAFQQELAARLAAKTTQQVEQSRLGLACAGKQWLIRLADAGEVI |
| Ga0302323_1005223313 | 3300031232 | Fen | MARAAKLDLRTFQQELSARLLTKTAAQVESSRLGLSCGGERWLIRLVDAGEV |
| Ga0302323_1010069441 | 3300031232 | Fen | MARAAKLDLRAFQQELATRLAAKTTAQVEQSRLGLACAG |
| Ga0311364_106254521 | 3300031521 | Fen | MARTAKLDLRTFQQELAARLATKTTAQVESSRLGLASGGERWLVRL |
| Ga0311364_109836911 | 3300031521 | Fen | MARAAKLDLRTFQQELASRLATKTTAQVESSRLGLASGGERW |
| Ga0307408_1025119682 | 3300031548 | Rhizosphere | MARAAKLDLRTFQQELTTRLASKTAAQVESSRLGLSCGGERWLIRLG |
| Ga0310813_121981351 | 3300031716 | Soil | MSRAARLDLRSFQKELASRLASKTAAQVESSRLGIACG |
| Ga0307469_108569573 | 3300031720 | Hardwood Forest Soil | MARAARIDLRTFQHELASRLATKTAAQVEASRLGLLSGGMRWLVRLADAGEVITVPTIVG |
| Ga0307469_112296253 | 3300031720 | Hardwood Forest Soil | MARRAAKLDLRAFQQELATRLAAKTTAQVEQSRLGLDCAG |
| Ga0307469_116457082 | 3300031720 | Hardwood Forest Soil | MTTMVRPARIDLQSFQQELANRLASKTAAQVESSRLGLACGGERFLIRLGDA |
| Ga0311351_109583342 | 3300031722 | Fen | MARAAKVDLRSFQQELASRLATKTAAQVESSRLGLACGGAQWLIRLADAGEVIT |
| Ga0318500_100611154 | 3300031724 | Soil | MARAARLDLRSFQQELAARLATKTAAQVEQSRLGLSCAGERWLI |
| Ga0302321_1008040863 | 3300031726 | Fen | MARTARIDLRSFQHELATRLASKTAAQVESSRLGLASGGEQWLIPLADAAEVIAMPTVAS |
| Ga0302321_1016625883 | 3300031726 | Fen | MARAAKLDLRAFQQELATRLAAKTSAQVEQSRLGLACAGAQWLIRLADAGEVI |
| Ga0307405_104233951 | 3300031731 | Rhizosphere | MARAAKLDLRTFQQELATRLASKTAAQVESSRLGLAC |
| Ga0307477_110185552 | 3300031753 | Hardwood Forest Soil | MARAAKLDLRAFQRELATRLAAKTTAQVEQSRLGLACAGEQWLIRL |
| Ga0318557_104762272 | 3300031795 | Soil | MTTMVRPARIDLQSFQQELANRLAAKTAAQVESSRLGLACGGE |
| Ga0318523_105067262 | 3300031798 | Soil | MARAAKLDLRAFQQELATRLAAKTAAQVEQSRLGVGCAGEQWLI |
| Ga0307473_106319601 | 3300031820 | Hardwood Forest Soil | MARPARIDLQSFQQELANRLASKTAAQVESSRLGLACGGERFLIRLGDAAE |
| Ga0315290_111224893 | 3300031834 | Sediment | MARAARVDLRSFQQELANRLASKTAAQVESSRLGLACGG |
| Ga0315290_112150482 | 3300031834 | Sediment | MARAGKIDLRVFQQELATRLAGKTAAEVESSRLGLASAGQQWLIRLADAGEVIALP |
| Ga0310892_100811484 | 3300031858 | Soil | MARAAKLDLRAFQRELASRLASKTAAQVESSRLGL |
| Ga0310892_102289473 | 3300031858 | Soil | MARAAKLDLRTFQQELAARLASKTAAQVESSRLGLACGGDQWLVRLGDAGEVVTVP |
| Ga0315297_101137451 | 3300031873 | Sediment | MARADKLDLRVFQQELAVRLASKTAAQVESSRLGLAAAGQRWLIRLADAGEVIAMPQLA |
| Ga0315297_110145401 | 3300031873 | Sediment | MARTAKLDLRTFQQELAARLATKTTAQVESSRLGLASGGERWLV |
| Ga0306925_107797681 | 3300031890 | Soil | MARAARLDLRAFQQELATRLAAKTAAQVEQSRLGVACVGAQWLIRLADAGEVIAVP |
| Ga0307406_1000112317 | 3300031901 | Rhizosphere | MARAAKLDLRTFQQELATRLASKTAAQVESSRLGLACGGEQWLLR |
| Ga0310900_100346231 | 3300031908 | Soil | MARAAKLDLRAFQRELASRLASKTAAQVESSRLGLAC |
| Ga0311367_115783431 | 3300031918 | Fen | MARAAKLDLRTFQQELATRLASKTAAQVESSRLGLA |
| Ga0311367_117484692 | 3300031918 | Fen | MARAGKLDLRLFQQELASRLASKTTAQVESSRLGLACAGRQWLIRLADAGEVIAM |
| Ga0308175_1003126751 | 3300031938 | Soil | MARAAKLDLRTFQQELSTRLAAKTAAQVESSRLGLECAGQRWLMRLGDAGEVIAMPTV |
| Ga0308174_108525891 | 3300031939 | Soil | MARAARLDLRTFQQELATRLASKTAAQVESSRLGLACAGQNWLVRLAD |
| Ga0308174_117353332 | 3300031939 | Soil | MARAAKLDLRTFQQELTTRLASKTAAQVESSRLGLSCG |
| Ga0310912_109185873 | 3300031941 | Soil | MARAPRIDLRTFQQELAARLATKTAAQVESSRLGLSSGSERW |
| Ga0310916_104513281 | 3300031942 | Soil | MVRPARIDLQSFQQELANRLAAKTAAQVESSRLGLACGGERFLIRLGDAAEVVA |
| Ga0310916_117596421 | 3300031942 | Soil | MARAARLDLRAFQQELATRLAAKTAAQVEQSRLGVACVG |
| Ga0308176_129912082 | 3300031996 | Soil | MARAVKAKLDLRTFQQELTSRLVAKTAAQVESTRLGLSCAGQRWLIRLADAGEVIAIPTI |
| Ga0315278_109507541 | 3300031997 | Sediment | MARAGKLDLRLFQQELAARLASKTTAQVESSRLGLACAGTQ |
| Ga0315278_117345971 | 3300031997 | Sediment | MARAGKIDLRVFQQELAARLAGKTTAEVESSRLGLASAG |
| Ga0307416_1033084461 | 3300032002 | Rhizosphere | MARAGKLDLRSFQQELATRLASKTAAQVESSRLGLA |
| Ga0310897_106163432 | 3300032003 | Soil | VARAAKLDLRAFQRELASRLATKTAAQVESSRLGLSCGGDRWLMRLADAG |
| Ga0307411_103467751 | 3300032005 | Rhizosphere | MARAAKLDLRAFQQELAARLASKTAAQVESSRLSLACA |
| Ga0318562_101672193 | 3300032008 | Soil | MVRPARIDLQSFQQELANRLAAKTAAQVESSRLGLACG |
| Ga0318563_106096672 | 3300032009 | Soil | MARTARIDLRRFQQELAARLAAKTAAQVESSRLGLACAGDQWLIRLADAAEVIAVPDLAAVP |
| Ga0318510_104598702 | 3300032064 | Soil | MARAARLDLRSFQQELAARLATKTAAQVEQSRLGLSCAGHGVGDE |
| Ga0310890_101413181 | 3300032075 | Soil | MSRPARLDLRSFQQELATRLAAKTAAQVESSRLGFSCGDERWLIR |
| Ga0315277_106879323 | 3300032118 | Sediment | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGEQWLIRLADAAEVVALP |
| Ga0307415_1009833561 | 3300032126 | Rhizosphere | MARAAKLDLRTFQQELATRLASKTAAQVESSRLGLSC |
| Ga0315281_112418981 | 3300032163 | Sediment | MSRPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLIRLADAAEVVAVP |
| Ga0315283_113846263 | 3300032164 | Sediment | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLVRLAD |
| Ga0307470_102243213 | 3300032174 | Hardwood Forest Soil | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLIRLADAAE |
| Ga0307470_119055312 | 3300032174 | Hardwood Forest Soil | MARAAKLDLRSFQRELASRLATKTAAQVESSRLGLACGGSQWLIRLADAGEVI |
| Ga0315276_120060682 | 3300032177 | Sediment | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLVRLADAAEV |
| Ga0307472_1025724602 | 3300032205 | Hardwood Forest Soil | MTTMVRPARIDLQSFQQELANRLASKTAAQVESSRLGLACGGERFLIRLGDAAE |
| Ga0310896_108153631 | 3300032211 | Soil | MARPARIDLRLFQQELATRLASKTTAQVESSRLGLSCAGERWLIRLADAA |
| Ga0315271_111076822 | 3300032256 | Sediment | MARPARIDLRVFQQELATRLASKTTAEVESSRLGLSCVGERWLIRLADAAEVIAVP |
| Ga0315287_101550654 | 3300032397 | Sediment | MARPARIDLRSFQDELATRLAAKTAAQVESSRLGLACGGACWLIRLGDAAEVI |
| Ga0315287_104298704 | 3300032397 | Sediment | MARAAKLDLRTFQKELASRLATKTAAQVESSRLGLSSGGERWLIRLADAG |
| Ga0315287_118053463 | 3300032397 | Sediment | MPRPARIDLRLFQQELATRLASKTTAQVESSRLGLNCAGERWLIRLADAAEVVA |
| Ga0315287_123970991 | 3300032397 | Sediment | MARAARIDLRSFQDELATRLTARTAAQVESSRLGLASGAERWL |
| Ga0315273_102857564 | 3300032516 | Sediment | MSRPARIDLRLFQQELATRLASKTTAQVQSSRLGLSCA |
| Ga0335082_108853031 | 3300032782 | Soil | MTTTVRSPRIDLQSFQQELANRLAAKTAAQVESSRLGLACGGERFLIRLGDAAEVVAVPPIAGVPLT |
| Ga0335082_116889261 | 3300032782 | Soil | MARAAKLDLRSFQQELASRLATKTTAQVESSRLGLACGGSQWLIRLADAGEV |
| Ga0335070_111763151 | 3300032829 | Soil | MARAAKLDLRSFQQELASRLATKTTAQVESSRLGLACGGSQWLIRLAD |
| Ga0335083_101994211 | 3300032954 | Soil | MARAAKLDLRAFQQELATRLAAKTAAQVEQSRLGVDCAGERWLIR |
| Ga0318519_101618051 | 3300033290 | Soil | MARAARLDLRSFQQELAARLATKTAAQVEQSRLGL |
| Ga0310810_107165961 | 3300033412 | Soil | MSRAARLDLRSFQKELASRLASKTAAQVESSRLGIACGERRWLIRLGDAGEVI |
| Ga0316622_1009047841 | 3300033416 | Soil | MARSAKLDLRSFQQELATRLASKTAAQVESSRLGLAC |
| Ga0316622_1023553421 | 3300033416 | Soil | MARAAKLDLRVFQQELATRLASKTVAQVESSRLGLAC |
| Ga0326726_107245493 | 3300033433 | Peat Soil | MARAAKLDLRAFQQELATRLASKTAAQVESSRLGLACGGDQWLVRL |
| Ga0326726_111501213 | 3300033433 | Peat Soil | MVRPARIDLQSFQQELANRLASKTAAQVESSRLGLSCGGER |
| Ga0316627_1003634103 | 3300033482 | Soil | MARTAKLDLRAFQQELATRLASKTAGEVESSRLGLSFGGRNWLI |
| Ga0316629_102812221 | 3300033483 | Soil | MARTAKLDLRVFQQELAARLANKTAAQVESSRLGLASA |
| Ga0316629_108250381 | 3300033483 | Soil | MARSAKLDLRSFQQELATRLASKTAAQVESSRLGLACAGDRWLIRLADAGEVITVPPIA |
| Ga0316621_104246233 | 3300033488 | Soil | MARAAKLDLRVFQQELATRLASKTVAQVESSRLGLACAGEQWLIRLSDAVEVIA |
| Ga0364934_0366736_402_545 | 3300034178 | Sediment | MARAAKLDLRSFQQELAARLASKTTAQVESSRLGFASGGLQWLIRLAD |
| Ga0370508_0317514_390_518 | 3300034197 | Untreated Peat Soil | MARAAKLDLRTFQQELASRLATKTAAQVESSRLGLSSGSDRWL |
| Ga0372943_0756066_1_165 | 3300034268 | Soil | MARAAKLDLRSFQQELATRLATKTAAQVESSRLGLSCAGSRWLIRLADAGEVITL |
| ⦗Top⦘ |