Metagenome / Metatranscriptome Family F003627

Overview

Basic Information

• Family ID: F003627
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 476
• Average Sequence Length: 37 residues
• Representative Sequence: VDRETARKNMGAGLVAGGIAAAVFALCFVAAFLYIAQ
• Number of Associated Samples: 325
• Number of Associated Scaffolds: 476

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 18.53 %
• % of genes near scaffold ends (potentially truncated): 12.39 %
• % of genes from short scaffolds (< 2000 bps): 64.29 %
• Associated GOLD sequencing projects: 293
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (64.076 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.378 % of family members)
• Environment Ontology (ENVO): Unclassified (41.807 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (42.017 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 52.31%
  β-sheet: 0.00%
  Coil/Unstructured: 47.69%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 476 Family Scaffolds
PF01040	UbiA	27.94
PF00571	CBS	22.90
PF02628	COX15-CtaA	5.46
PF00115	COX1	4.62
PF00034	Cytochrom_C	4.41
PF00116	COX2	1.68
PF00510	COX3	1.47
PF14378	PAP2_3	1.05
PF02790	COX2_TM	0.42
PF13442	Cytochrome_CBB3	0.42
PF02148	zf-UBP	0.42
PF13560	HTH_31	0.42
PF01061	ABC2_membrane	0.42
PF00378	ECH_1	0.42
PF09656	PGPGW	0.42
PF04961	FTCD_C	0.21
PF00561	Abhydrolase_1	0.21
PF13460	NAD_binding_10	0.21
PF03706	LPG_synthase_TM	0.21
PF07676	PD40	0.21
PF12681	Glyoxalase_2	0.21
PF01176	eIF-1a	0.21
PF00484	Pro_CA	0.21
PF00768	Peptidase_S11	0.21
PF00246	Peptidase_M14	0.21
PF06570	DUF1129	0.21
PF13531	SBP_bac_11	0.21
PF00368	HMG-CoA_red	0.21
PF12697	Abhydrolase_6	0.21
PF07690	MFS_1	0.21
PF02401	LYTB	0.21
PF02597	ThiS	0.21
PF01476	LysM	0.21
PF05297	Herpes_LMP1	0.21
PF14864	Alkyl_sulf_C	0.21
PF05977	MFS_3	0.21
PF00958	GMP_synt_C	0.21
PF00478	IMPDH	0.21
PF11832	DUF3352	0.21
PF06463	Mob_synth_C	0.21
PF06314	ADC	0.21
PF00293	NUDIX	0.21
PF02538	Hydantoinase_B	0.21
PF10084	DUF2322	0.21
PF00380	Ribosomal_S9	0.21
PF13692	Glyco_trans_1_4	0.21
PF01035	DNA_binding_1	0.21
PF02397	Bac_transf	0.21
PF07992	Pyr_redox_2	0.21
PF03853	YjeF_N	0.21
PF05199	GMC_oxred_C	0.21
PF02583	Trns_repr_metal	0.21
PF01566	Nramp	0.21
PF13420	Acetyltransf_4	0.21
PF05988	DUF899	0.21

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 476 Family Scaffolds
COG1612	Heme A synthase	Coenzyme transport and metabolism [H]	5.46
COG1622	Heme/copper-type cytochrome/quinol oxidase, subunit 2	Energy production and conversion [C]	2.10
COG4263	Nitrous oxide reductase	Inorganic ion transport and metabolism [P]	1.68
COG1845	Heme/copper-type cytochrome/quinol oxidase, subunit 3	Energy production and conversion [C]	1.47
COG5207	Uncharacterized Zn-finger protein, UBP-type	General function prediction only [R]	0.42
COG0761	4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH	Lipid transport and metabolism [I]	0.42
COG0146	N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit	Amino acid transport and metabolism [E]	0.42
COG4312	Predicted dithiol-disulfide oxidoreductase, DUF899 family	General function prediction only [R]	0.21
COG3695	Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain	Transcription [K]	0.21
COG4689	Acetoacetate decarboxylase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.21
COG3404	Formiminotetrahydrofolate cyclodeaminase	Amino acid transport and metabolism [E]	0.21
COG4858	Uncharacterized membrane-anchored protein	Function unknown [S]	0.21
COG2896	GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA)	Coenzyme transport and metabolism [H]	0.21
COG1914	Mn2+ or Fe2+ transporter, NRAMP family	Inorganic ion transport and metabolism [P]	0.21
COG2814	Predicted arabinose efflux permease AraJ, MFS family	Carbohydrate transport and metabolism [G]	0.21
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	0.21
COG2148	Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)	Cell wall/membrane/envelope biogenesis [M]	0.21
COG2104	Sulfur carrier protein ThiS (thiamine biosynthesis)	Coenzyme transport and metabolism [H]	0.21
COG1977	Molybdopterin synthase sulfur carrier subunit MoaD	Coenzyme transport and metabolism [H]	0.21
COG1937	DNA-binding transcriptional regulator, FrmR family	Transcription [K]	0.21
COG0062	NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain	Nucleotide transport and metabolism [F]	0.21
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.21
COG1257	Hydroxymethylglutaryl-CoA reductase	Lipid transport and metabolism [I]	0.21
COG0519	GMP synthase, PP-ATPase domain/subunit	Nucleotide transport and metabolism [F]	0.21
COG0392	Predicted membrane flippase AglD2/YbhN, UPF0104 family	Cell wall/membrane/envelope biogenesis [M]	0.21
COG0361	Translation initiation factor IF-1	Translation, ribosomal structure and biogenesis [J]	0.21
COG0350	DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)	Replication, recombination and repair [L]	0.21
COG0288	Carbonic anhydrase	Inorganic ion transport and metabolism [P]	0.21
COG0103	Ribosomal protein S9	Translation, ribosomal structure and biogenesis [J]	0.21

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	64.08 %
Unclassified	root	N/A	35.92 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	64.08 %
Unclassified	root	N/A	35.92 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	64.08 %
Unclassified	root	N/A	35.92 %

Level 4

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	57.35 %
Unclassified	root	N/A	35.92 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.78 %

Level 5

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	56.93 %
Unclassified	root	N/A	35.92 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3.36 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.42 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.21 %

Level 6

Name	Rank	Taxonomy	Distribution
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	41.39 %
Unclassified	root	N/A	35.92 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	3.36 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.42 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.21 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.92 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	15.13 %
Thermoleophilales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales	3.99 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	3.36 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.42 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.21 %
Miltoncostaeales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales	0.63 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.92 %
unclassified Solirubrobacterales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales	5.04 %
Thermoleophilaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae	3.99 %
Klebsiella/Raoultella group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group	3.36 %
Conexibacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae	1.26 %
Tolypothrichaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae	0.42 %
Methyloceanibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter	0.21 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	0.21 %
Miltoncostaeaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae	0.63 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.92 %
Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	4.83 %
Thermoleophilum	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum	3.99 %
Klebsiella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella	3.36 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	1.26 %
Tolypothrix	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix	0.42 %
Solirubrobacterales bacterium 70-9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	0.21 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.21 %
Methyloceanibacter caenitepidi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	0.21 %
Miltoncostaea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea	0.63 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.92 %
Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	4.83 %
Thermoleophilum album	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	3.99 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	3.36 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.26 %
Tolypothrix campylonemoides	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides	0.42 %
Solirubrobacterales bacterium 70-9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	0.21 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.21 %
Methyloceanibacter caenitepidi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	0.21 %
Miltoncostaea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea	0.63 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.92 %
Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	4.83 %
Thermoleophilum album	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	3.99 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	3.36 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.26 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	0.42 %
Solirubrobacterales bacterium 70-9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	0.21 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.21 %
Methyloceanibacter caenitepidi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	0.21 %
Miltoncostaea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea	0.63 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2124908035|B3_GZOS_CLC_ConsensusfromContig110920	Not Available	711
2124908044|A5_c1_ConsensusfromContig12421	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1398
2140918007|ConsensusfromContig172092	Not Available	636
3300000858|JGI10213J12805_10219582	Not Available	1123
3300000953|JGI11615J12901_14471202	Not Available	559
3300000956|JGI10216J12902_100553435	All Organisms → cellular organisms → Bacteria	1754
3300000956|JGI10216J12902_100915295	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1395
3300000956|JGI10216J12902_104804225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1127
3300000956|JGI10216J12902_113275823	Not Available	512
3300000956|JGI10216J12902_114113440	Not Available	747
3300000956|JGI10216J12902_126470761	Not Available	550
3300001405|JGI20186J14852_1001884	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1452
3300001686|C688J18823_10815282	Not Available	593
3300001977|JGI24746J21847_1000113	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	9482
3300001979|JGI24740J21852_10022756	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2152
3300002239|JGI24034J26672_10000115	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	12949
3300003997|Ga0055466_10281911	Not Available	505
3300004001|Ga0055450_10000087	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	14428
3300004114|Ga0062593_102057149	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	636
3300004643|Ga0062591_100413180	All Organisms → cellular organisms → Bacteria	1121
3300005329|Ga0070683_100521332	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1136
3300005334|Ga0068869_101497608	Not Available	599
3300005337|Ga0070682_101944814	Not Available	516
3300005344|Ga0070661_100790109	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	778
3300005366|Ga0070659_101539916	Not Available	593
3300005458|Ga0070681_10118723	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2581
3300005526|Ga0073909_10454747	Not Available	612
3300005543|Ga0070672_100000031	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	62241
3300005548|Ga0070665_100002868	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	18629
3300005548|Ga0070665_100038076	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	4835
3300005548|Ga0070665_100467901	All Organisms → cellular organisms → Bacteria	1271
3300005548|Ga0070665_101210830	Not Available	766
3300005548|Ga0070665_101683816	Not Available	642
3300005563|Ga0068855_101016967	Not Available	870
3300005563|Ga0068855_102139279	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	563
3300005564|Ga0070664_100052530	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	3453
3300005564|Ga0070664_100918918	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	821
3300005577|Ga0068857_101641337	Not Available	628
3300005578|Ga0068854_100000082	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	68340
3300005578|Ga0068854_100879972	All Organisms → cellular organisms → Bacteria	786
3300005614|Ga0068856_100563038	Not Available	1161
3300005614|Ga0068856_101787964	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	626
3300005614|Ga0068856_102642372	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	508
3300005616|Ga0068852_100000994	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	18720
3300005616|Ga0068852_101493211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	698
3300005618|Ga0068864_100000090	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	96213
3300005718|Ga0068866_10000206	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	27716
3300005718|Ga0068866_10016679	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	3289
3300005764|Ga0066903_108227354	Not Available	534
3300005834|Ga0068851_10003112	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	7354
3300005841|Ga0068863_100121298	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2493
3300005841|Ga0068863_100533418	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1158
3300005843|Ga0068860_100085478	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	3002
3300005843|Ga0068860_101774186	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	639
3300005873|Ga0075287_1030303	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	701
3300005873|Ga0075287_1037430	Not Available	644
3300005983|Ga0081540_1000557	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	36162
3300005983|Ga0081540_1217042	Not Available	683
3300006038|Ga0075365_10749302	Not Available	690
3300006175|Ga0070712_100844868	Not Available	787
3300006237|Ga0097621_100917831	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	816
3300006573|Ga0074055_11833654	Not Available	715
3300006578|Ga0074059_11844374	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	583
3300006581|Ga0074048_12716516	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	678
3300006606|Ga0074062_13026934	Not Available	849
3300006640|Ga0075527_10003111	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	3931
3300006640|Ga0075527_10004485	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	3372
3300006642|Ga0075521_10443242	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	634
3300006755|Ga0079222_10350031	Not Available	997
3300006755|Ga0079222_10378357	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	973
3300006755|Ga0079222_10810359	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	766
3300006755|Ga0079222_12077689	Not Available	561
3300006792|Ga0075530_1124152	Not Available	831
3300006804|Ga0079221_11420534	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	553
3300006845|Ga0075421_100052138	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	5176
3300006846|Ga0075430_100206320	Not Available	1631
3300006853|Ga0075420_100184089	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1827
3300006854|Ga0075425_100072500	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3881
3300006854|Ga0075425_100247935	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2049
3300006854|Ga0075425_100625637	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1238
3300006876|Ga0079217_11178683	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	581
3300006881|Ga0068865_101561911	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	592
3300006904|Ga0075424_100620086	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1155
3300006953|Ga0074063_12907598	Not Available	538
3300006954|Ga0079219_12122012	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	539
3300007614|Ga0102946_1000094	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	29309
3300007614|Ga0102946_1005686	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4133
3300007757|Ga0102949_1005407	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	2476
3300009011|Ga0105251_10598656	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	523
3300009093|Ga0105240_11294740	Not Available	769
3300009098|Ga0105245_10038238	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4270
3300009101|Ga0105247_10000131	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	72578
3300009112|Ga0115923_10159576	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	6547
3300009147|Ga0114129_12316412	Not Available	644
3300009156|Ga0111538_10654955	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1331
3300009156|Ga0111538_13978721	Not Available	511
3300009162|Ga0075423_10372678	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1498
3300009174|Ga0105241_10116429	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2146
3300009176|Ga0105242_10000428	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	33565
3300009176|Ga0105242_10632194	Not Available	1038
3300009176|Ga0105242_11293836	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	752
3300009545|Ga0105237_10257220	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1748
3300009551|Ga0105238_10000033	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	172981
3300009551|Ga0105238_10476263	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1247
3300009553|Ga0105249_10000218	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	65480
3300009553|Ga0105249_10738102	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1046
3300009553|Ga0105249_11034453	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	890
3300009553|Ga0105249_11398991	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	771
3300009610|Ga0105340_1321008	Not Available	679
3300009789|Ga0126307_10037119	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	3773
3300009789|Ga0126307_10995031	Not Available	678
3300009789|Ga0126307_11708330	Not Available	512
3300009840|Ga0126313_10272624	Not Available	1317
3300009840|Ga0126313_10280002	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1300
3300009870|Ga0131092_10178996	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2263
3300009870|Ga0131092_10401499	Not Available	1276
3300010036|Ga0126305_10104745	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1705
3300010037|Ga0126304_10167226	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1429
3300010037|Ga0126304_10826320	Not Available	629
3300010039|Ga0126309_10000017	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	54762
3300010042|Ga0126314_11089025	Not Available	595
3300010043|Ga0126380_10882144	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	741
3300010044|Ga0126310_11117476	Not Available	628
3300010045|Ga0126311_10003129	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	8479
3300010045|Ga0126311_10139089	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1717
3300010045|Ga0126311_10258163	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1296
3300010045|Ga0126311_11323361	Not Available	599
3300010047|Ga0126382_11054215	Not Available	717
3300010051|Ga0133939_1071945	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1626
3300010166|Ga0126306_10189877	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1547
3300010166|Ga0126306_10395799	All Organisms → cellular organisms → Bacteria	1080
3300010323|Ga0134086_10332047	Not Available	597
3300010359|Ga0126376_11924254	Not Available	632
3300010360|Ga0126372_12488306	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	569
3300010362|Ga0126377_10310066	Not Available	1559
3300010371|Ga0134125_13049001	Not Available	508
3300010373|Ga0134128_11476005	Not Available	749
3300010373|Ga0134128_12068987	Not Available	627
3300010375|Ga0105239_10487371	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1401
3300010396|Ga0134126_10033254	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	6521
3300010400|Ga0134122_12927715	Not Available	531
3300010403|Ga0134123_10083601	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	2495
3300010403|Ga0134123_10161789	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1865
3300011119|Ga0105246_11024624	Not Available	749
3300011418|Ga0153954_1142521	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	595
3300012014|Ga0120159_1077078	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea	986
3300012039|Ga0137421_1156282	Not Available	672
3300012090|Ga0153956_1001713	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	18287
3300012201|Ga0137365_10425872	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	978
3300012212|Ga0150985_100417282	Not Available	840
3300012212|Ga0150985_103669512	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	717
3300012212|Ga0150985_114396883	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	924
3300012212|Ga0150985_116019057	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea	1163
3300012212|Ga0150985_120976048	Not Available	681
3300012356|Ga0137371_10012271	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	6622
3300012469|Ga0150984_104121735	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	864
3300012469|Ga0150984_105559461	Not Available	895
3300012469|Ga0150984_115982619	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	606
3300012895|Ga0157309_10305733	Not Available	538
3300012900|Ga0157292_10000006	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	118494
3300012900|Ga0157292_10068576	Not Available	994
3300012907|Ga0157283_10000825	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	4369
3300012908|Ga0157286_10310134	Not Available	581
3300012909|Ga0157290_10000661	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	4566
3300012913|Ga0157298_10000004	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	155123
3300012914|Ga0157297_10241968	Not Available	648
3300012915|Ga0157302_10225747	Not Available	687
3300012924|Ga0137413_10259288	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1197
3300012924|Ga0137413_11804039	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	505
3300012929|Ga0137404_10863096	Not Available	824
3300012939|Ga0162650_100000300	All Organisms → cellular organisms → Bacteria	4040
3300012942|Ga0164242_10362293	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1074
3300012942|Ga0164242_10612386	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	765
3300012943|Ga0164241_10001524	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	28185
3300012943|Ga0164241_10017016	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	5825
3300012943|Ga0164241_10036645	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	3675
3300012944|Ga0137410_11251274	Not Available	640
3300012948|Ga0126375_12047334	Not Available	507
3300012951|Ga0164300_10341729	All Organisms → cellular organisms → Bacteria	800
3300012955|Ga0164298_10163283	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1265
3300012955|Ga0164298_10723404	Not Available	701
3300012955|Ga0164298_11420056	Not Available	538
3300012955|Ga0164298_11638586	Not Available	508
3300012957|Ga0164303_11096338	Not Available	574
3300012958|Ga0164299_10022671	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2604
3300012958|Ga0164299_10706124	Not Available	706
3300012958|Ga0164299_11237354	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	567
3300012985|Ga0164308_10605455	Not Available	933
3300012985|Ga0164308_11660472	Not Available	592
3300012986|Ga0164304_11099355	Not Available	636
3300012987|Ga0164307_10034647	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2768
3300012987|Ga0164307_10607999	Not Available	844
3300012987|Ga0164307_10968412	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	690
3300012989|Ga0164305_11221080	Not Available	653
3300013104|Ga0157370_10126005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2390
3300013297|Ga0157378_10016178	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	6532
3300013297|Ga0157378_10149338	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2176
3300013297|Ga0157378_11046379	Not Available	852
3300013306|Ga0163162_11217687	Not Available	855
3300013308|Ga0157375_10009414	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	8576
3300013308|Ga0157375_12514616	All Organisms → cellular organisms → Bacteria	615
3300013308|Ga0157375_12954415	Not Available	568
3300013772|Ga0120158_10310750	Not Available	758
3300014254|Ga0075312_1128446	Not Available	547
3300014254|Ga0075312_1134643	Not Available	538
3300014255|Ga0075320_1034971	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	864
3300014259|Ga0075311_1023598	Not Available	1111
3300014263|Ga0075324_1000003	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	192656
3300014267|Ga0075313_1207304	Not Available	522
3300014270|Ga0075325_1000062	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	13504
3300014270|Ga0075325_1015108	Not Available	1396
3300014270|Ga0075325_1104796	Not Available	671
3300014271|Ga0075326_1259371	Not Available	536
3300014299|Ga0075303_1003019	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1846
3300014300|Ga0075321_1069177	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	663
3300014301|Ga0075323_1121038	Not Available	579
3300014311|Ga0075322_1000344	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	6104
3300014314|Ga0075316_1021065	Not Available	1274
3300014325|Ga0163163_10278387	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1724
3300014325|Ga0163163_10289046	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1691
3300014325|Ga0163163_11593631	Not Available	714
3300014326|Ga0157380_10001343	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	16023
3300014487|Ga0182000_10008400	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	2435
3300014498|Ga0182019_10103938	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1742
3300014745|Ga0157377_10206552	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1250
3300014968|Ga0157379_10088527	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2777
3300014968|Ga0157379_10712100	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	943
3300014969|Ga0157376_10078125	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2833
3300015069|Ga0167633_114515	Not Available	918
3300015085|Ga0167632_1021861	Not Available	873
3300015089|Ga0167643_1031121	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	826
3300015090|Ga0167634_1003610	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2059
3300015200|Ga0173480_10931117	Not Available	567
3300015242|Ga0137412_10962701	Not Available	614
3300015242|Ga0137412_11038831	Not Available	584
3300015371|Ga0132258_11061157	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2048
3300017792|Ga0163161_10008446	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	7130
3300017930|Ga0187825_10125359	Not Available	898
3300017965|Ga0190266_10074556	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1303
3300018067|Ga0184611_1217818	Not Available	679
3300018071|Ga0184618_10159215	Not Available	927
3300018422|Ga0190265_10000063	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	122964
3300018422|Ga0190265_10054813	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	3503
3300018422|Ga0190265_10087103	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	2880
3300018422|Ga0190265_10148450	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2289
3300018429|Ga0190272_10011078	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	4432
3300018429|Ga0190272_10147731	Not Available	1612
3300018429|Ga0190272_10252473	Not Available	1325
3300018429|Ga0190272_10387094	Not Available	1134
3300018431|Ga0066655_10163967	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1335
3300018432|Ga0190275_10000304	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	47598
3300018432|Ga0190275_10003499	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	11225
3300018432|Ga0190275_11300242	Not Available	803
3300018432|Ga0190275_11758871	Not Available	698
3300018432|Ga0190275_12009533	Not Available	657
3300018465|Ga0190269_10001067	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	13332
3300018466|Ga0190268_10225737	Not Available	1050
3300018469|Ga0190270_10026236	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3709
3300018469|Ga0190270_10071919	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2521
3300018469|Ga0190270_10560405	Not Available	1104
3300018469|Ga0190270_10938055	Not Available	887
3300018469|Ga0190270_12033886	Not Available	633
3300018476|Ga0190274_10000037	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	126925
3300018476|Ga0190274_10000647	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	20387
3300018476|Ga0190274_10065204	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2719
3300018476|Ga0190274_10279527	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1537
3300018481|Ga0190271_10000013	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	178071
3300018481|Ga0190271_10000157	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	34663
3300018481|Ga0190271_10023657	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4803
3300018481|Ga0190271_10037326	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4000
3300018481|Ga0190271_10912305	Not Available	1003
3300018920|Ga0190273_10000018	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	124864
3300018920|Ga0190273_10212013	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1222
3300018920|Ga0190273_10497074	Not Available	891
3300018920|Ga0190273_11385435	Not Available	613
3300019377|Ga0190264_10250996	Not Available	1026
3300019377|Ga0190264_10614910	Not Available	779
3300019875|Ga0193701_1100403	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	538
3300019881|Ga0193707_1088164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	942
3300019884|Ga0193741_1016487	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1903
3300019889|Ga0193743_1001890	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	15113
3300020005|Ga0193697_1069486	Not Available	865
3300020020|Ga0193738_1034477	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1562
3300020021|Ga0193726_1047600	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2057
3300020021|Ga0193726_1050477	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1985
3300020022|Ga0193733_1102360	Not Available	799
3300020034|Ga0193753_10076177	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1723
3300020034|Ga0193753_10116183	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1314
3300020059|Ga0193745_1024786	Not Available	1315
3300020069|Ga0197907_10870875	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	907
3300020070|Ga0206356_10666627	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2422
3300020077|Ga0206351_10408391	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1040
3300020154|Ga0196965_1166214	Not Available	571
3300020181|Ga0196958_10002198	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	5976
3300020181|Ga0196958_10143598	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	820
3300020181|Ga0196958_10212246	Not Available	692
3300020610|Ga0154015_1540969	Not Available	806
3300021086|Ga0179596_10638289	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	540
3300021339|Ga0193706_1007093	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	4093
3300021339|Ga0193706_1012390	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2868
3300021339|Ga0193706_1053022	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1136
3300021363|Ga0193699_10119504	Not Available	1073
3300021401|Ga0210393_10295700	Not Available	1315
3300021403|Ga0210397_10085566	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2099
3300021412|Ga0193736_1057987	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	535
3300021445|Ga0182009_10641761	Not Available	571
3300021559|Ga0210409_10010053	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	9545
3300021560|Ga0126371_10936224	All Organisms → cellular organisms → Bacteria	1009
3300022756|Ga0222622_10049022	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2374
3300022756|Ga0222622_10603769	Not Available	792
3300022880|Ga0247792_1011158	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1384
3300022899|Ga0247795_1000128	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	11829
3300022910|Ga0247768_1000016	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	168636
3300023067|Ga0247743_1002044	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2237
3300023102|Ga0247754_1000752	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	5124
3300023265|Ga0247780_1001443	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	13674
3300023266|Ga0247789_1010551	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1448
3300023266|Ga0247789_1056555	Not Available	730
3300023268|Ga0247765_1005325	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3623
3300023275|Ga0247776_10000281	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	11878
3300024055|Ga0247794_10063550	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1037
3300024347|Ga0179591_1180883	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2787
3300024426|Ga0196960_10000579	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	12006
3300024426|Ga0196960_10063785	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1050
3300024430|Ga0196962_10000259	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	25574
3300024996|Ga0209916_1000951	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	33149
3300025321|Ga0207656_10017412	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	2815
3300025504|Ga0208356_1000005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	131014
3300025535|Ga0207423_1009837	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1471
3300025538|Ga0210132_1000139	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	9952
3300025552|Ga0210142_1006585	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2107
3300025565|Ga0210110_1002650	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	5140
3300025565|Ga0210110_1010855	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2429
3300025568|Ga0210095_1017120	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1654
3300025571|Ga0207874_1060801	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	876
3300025583|Ga0210085_1000593	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	15027
3300025593|Ga0210096_1198200	Not Available	558
3300025615|Ga0210086_1013182	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2985
3300025615|Ga0210086_1101045	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea	856
3300025625|Ga0208219_1003138	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	5777
3300025634|Ga0208589_1100834	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	680
3300025780|Ga0210100_1000230	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	9368
3300025780|Ga0210100_1000251	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	8607
3300025798|Ga0210063_1000059	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	35806
3300025799|Ga0210122_1009057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	2730
3300025814|Ga0210101_1000196	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	22236
3300025814|Ga0210101_1000339	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	16253
3300025814|Ga0210101_1104764	Not Available	741
3300025817|Ga0210144_1000148	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	40255
3300025817|Ga0210144_1000280	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	29393
3300025817|Ga0210144_1129479	Not Available	726
3300025823|Ga0210123_1049813	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1371
3300025823|Ga0210123_1122426	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	781
3300025854|Ga0209176_10016780	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1478
3300025878|Ga0209584_10277228	Not Available	643
3300025898|Ga0207692_10126787	Not Available	1437
3300025899|Ga0207642_10000005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	401934
3300025899|Ga0207642_10000737	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	10119
3300025899|Ga0207642_10019348	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2635
3300025905|Ga0207685_10000012	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	189900
3300025906|Ga0207699_11133220	Not Available	579
3300025908|Ga0207643_10663734	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	673
3300025911|Ga0207654_10650429	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	755
3300025912|Ga0207707_10059817	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	3315
3300025912|Ga0207707_11095448	Not Available	649
3300025915|Ga0207693_10010825	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	7404
3300025915|Ga0207693_11212994	Not Available	568
3300025919|Ga0207657_10166653	Not Available	1787
3300025924|Ga0207694_10000012	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	411218
3300025924|Ga0207694_10496541	Not Available	1022
3300025926|Ga0207659_10000055	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	74252
3300025927|Ga0207687_10020955	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4339
3300025928|Ga0207700_10000003	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	500797
3300025929|Ga0207664_10015535	All Organisms → cellular organisms → Bacteria	5529
3300025934|Ga0207686_10339430	Not Available	1128
3300025937|Ga0207669_10107293	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1862
3300025938|Ga0207704_10245347	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	1341
3300025938|Ga0207704_11253647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	633
3300025939|Ga0207665_11437424	Not Available	549
3300025946|Ga0210126_100464	All Organisms → cellular organisms → Bacteria	3202
3300025949|Ga0207667_10617093	Not Available	1092
3300025949|Ga0207667_10700316	Not Available	1015
3300025961|Ga0207712_10000027	All Organisms → cellular organisms → Bacteria	263739
3300025961|Ga0207712_11045290	Not Available	726
3300025961|Ga0207712_11213984	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	673
3300025986|Ga0207658_10103947	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	2231
3300025986|Ga0207658_10486284	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1097
3300025986|Ga0207658_10532709	Not Available	1049
3300025996|Ga0208777_1010761	Not Available	775
3300025996|Ga0208777_1013266	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	699
3300026023|Ga0207677_10003648	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	8170
3300026023|Ga0207677_10009001	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	5602
3300026051|Ga0208911_1000261	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4107
3300026051|Ga0208911_1004916	Not Available	1204
3300026058|Ga0208421_1018676	Not Available	626
3300026066|Ga0208290_1000039	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	5761
3300026067|Ga0207678_10118785	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2256
3300026067|Ga0207678_10347112	All Organisms → cellular organisms → Bacteria → Proteobacteria	1280
3300026075|Ga0207708_10524947	Not Available	995
3300026088|Ga0207641_10076027	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2902
3300026095|Ga0207676_10000016	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	311561
3300026107|Ga0209950_1005058	Not Available	1410
3300026121|Ga0207683_10196742	All Organisms → cellular organisms → Bacteria	1832
3300026142|Ga0207698_11593350	All Organisms → cellular organisms → Bacteria	668
3300026142|Ga0207698_11721077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	642
3300026142|Ga0207698_12265682	Not Available	555
3300027524|Ga0208998_1000008	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	116202
3300027636|Ga0214469_1002897	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	6389
3300027636|Ga0214469_1145766	Not Available	670
3300027725|Ga0209178_1358226	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	547
3300027787|Ga0209074_10447444	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	551
3300027909|Ga0209382_10023534	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	7459
3300028293|Ga0247662_1064979	Not Available	644
3300028379|Ga0268266_10015588	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	6515
3300028379|Ga0268266_11199042	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	734
3300028380|Ga0268265_12430781	Not Available	530
3300028381|Ga0268264_10001191	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	25160
3300028381|Ga0268264_12137917	Not Available	568
3300028556|Ga0265337_1001256	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	12773
3300028556|Ga0265337_1199593	Not Available	543
3300028558|Ga0265326_10156483	Not Available	651
3300028712|Ga0307285_10000004	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	246966
3300028714|Ga0307309_10056196	Not Available	867
3300028721|Ga0307315_10057660	Not Available	1091
3300028768|Ga0307280_10000024	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	47053
3300028768|Ga0307280_10252238	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	635
3300028768|Ga0307280_10260103	Not Available	626
3300028782|Ga0307306_10000044	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	25664
3300028802|Ga0307503_10000132	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	35030
3300028802|Ga0307503_10629734	Not Available	595
3300028875|Ga0307289_10035626	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1970
3300029987|Ga0311334_11820946	Not Available	519
3300030006|Ga0299907_10203087	Not Available	1635
3300030499|Ga0268259_10092395	Not Available	668
3300030510|Ga0268243_1006865	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	2026
3300031184|Ga0307499_10005236	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2673
3300031226|Ga0307497_10489173	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	605
3300031228|Ga0299914_10000191	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	36365
3300031228|Ga0299914_10010643	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	7051
3300031229|Ga0299913_10093294	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2933
3300031274|Ga0307442_1132132	Not Available	709
3300031367|Ga0307440_1007722	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4139
3300031367|Ga0307440_1143474	Not Available	664
3300031411|Ga0102761_12173612	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	547
3300031740|Ga0307468_101028947	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	727
3300031873|Ga0315297_10354097	Not Available	1229
3300031938|Ga0308175_100000371	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	31471
3300031996|Ga0308176_10487991	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1248
3300032002|Ga0307416_103064029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	559
3300032074|Ga0308173_11852421	Not Available	569
3300032080|Ga0326721_10000051	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	96017
3300032126|Ga0307415_100649460	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	945
3300032157|Ga0315912_11201659	Not Available	601
3300032174|Ga0307470_10008781	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	4095
3300032174|Ga0307470_11080195	Not Available	644
3300032180|Ga0307471_100178776	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2090
3300032205|Ga0307472_101189987	Not Available	727
3300032205|Ga0307472_101428365	Not Available	672
3300032829|Ga0335070_10000099	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	97495
3300032829|Ga0335070_10109147	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2881
3300032829|Ga0335070_10190739	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2048
3300032829|Ga0335070_10238497	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1789
3300032896|Ga0335075_10466718	Not Available	1307
3300032896|Ga0335075_11293618	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	624
3300032954|Ga0335083_10000084	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	167442
3300032954|Ga0335083_11336632	Not Available	550
3300033433|Ga0326726_10028034	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	4900
3300034125|Ga0370484_0042838	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	1107
3300034128|Ga0370490_0174418	Not Available	705
3300034147|Ga0364925_0018486	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2196
3300034402|Ga0334960_000648	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	12916
3300034687|Ga0334905_000287	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	7295
3300034690|Ga0364923_0014158	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1759
3300034781|Ga0334935_102643	Not Available	781
3300034965|Ga0370497_0055924	Not Available	881

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	69.54%
Host-Associated	Host-Associated	29.20%
Engineered	Engineered	1.26%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	61.97%
Plants	Host-Associated → Plants	28.78%
Aquatic	Environmental → Aquatic	7.56%
Wastewater	Engineered → Wastewater	0.63%
Fungi	Host-Associated → Fungi	0.42%
Lab Enrichment	Engineered → Lab Enrichment	0.21%
Built Environment	Engineered → Built Environment	0.21%
Bioremediation	Engineered → Bioremediation	0.21%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	60.08%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.18%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.34%
Marine	Environmental → Aquatic → Marine	5.88%
Sediment	Environmental → Aquatic → Sediment	1.26%
Roots	Host-Associated → Plants → Roots	1.05%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.84%
Freshwater	Environmental → Aquatic → Freshwater	0.42%
Peat	Environmental → Terrestrial → Peat	0.42%
Floodplain	Environmental → Terrestrial → Floodplain	0.42%
Mycelium	Host-Associated → Fungi → Mycelium	0.42%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.42%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.21%
Phyllosphere	Host-Associated → Plants → Phyllosphere	0.21%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.21%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.21%
Unclassified	Engineered → Built Environment → Unclassified	0.21%
Hydrocarbon	Engineered → Bioremediation → Hydrocarbon	0.21%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	46.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.71%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.87%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.19%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.46%
Wetlands	Environmental → Aquatic → Marine → Wetlands	5.25%
Loam	Environmental → Terrestrial → Soil → Loam	3.78%
Sand	Environmental → Terrestrial → Soil → Sand	1.47%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.26%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.26%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.84%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.84%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.63%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.42%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.42%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.42%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.42%
Lake	Environmental → Aquatic → Freshwater → Lake	0.21%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.21%
Soil Crust	Environmental → Terrestrial → Soil → Soil Crust	0.21%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.21%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.21%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.21%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	0.21%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.21%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified	0.21%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified	0.21%
Unclassified	Engineered → Bioremediation → Hydrocarbon → Unclassified	0.21%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	33.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.71%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.87%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	7.98%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.46%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	5.25%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.78%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	3.15%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.15%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.31%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.89%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	1.47%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.26%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.26%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.05%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.84%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.84%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.63%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.63%
Desert	Environmental → Terrestrial → Soil → Unclassified → Desert	0.42%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.42%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.42%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.42%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.42%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.42%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.21%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.21%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.21%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.21%
Unclassified	Environmental → Terrestrial → Soil → Soil Crust → Unclassified	0.21%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.21%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.21%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.21%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	0.21%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.21%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified	0.21%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified → Unclassified	0.21%
Unclassified	Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified	0.21%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	20.38%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	5.25%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	3.99%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.78%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	3.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.73%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.10%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	2.10%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.10%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.10%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.52%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.68%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.68%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.47%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.47%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	1.47%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.47%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.47%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.26%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.05%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.05%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.05%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.05%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.84%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.84%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.84%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.84%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.84%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.63%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.63%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.63%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.63%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.63%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.42%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.42%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.42%
Compost	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost	0.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.42%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.42%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.42%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.42%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.42%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.42%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.42%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.42%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.21%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.21%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.21%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.21%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.21%
Soil	Environmental → Terrestrial → Soil → Unclassified → Desert → Soil	0.21%
Sub-Biocrust Soil	Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil	0.21%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.21%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.21%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.21%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.21%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.21%
Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust	0.21%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.21%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.21%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.21%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.21%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.21%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.21%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.21%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.21%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	0.21%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater	0.21%
Ionic Liquid And High Solid Enriched	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched	0.21%
Swimming Pool Sandfilter Backwash	Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash	0.21%
Wastewater Bioreactor	Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor	0.21%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2124908035	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3	Environmental
2124908044	Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5	Environmental
2140918007	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all	Environmental
3300000858	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil	Environmental
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300001405	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012	Environmental
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental
3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Host-Associated
3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Host-Associated
3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Host-Associated
3300003997	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1	Environmental
3300004001	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1	Environmental
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300005873	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301	Environmental
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006573	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)	Environmental
3300006578	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)	Environmental
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental
3300006640	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B	Environmental
3300006642	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D	Environmental
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006792	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D	Environmental
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300007614	Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG	Environmental
3300007757	Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D1_MG	Environmental
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated
3300009112	Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2	Engineered
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental
3300010051	Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196	Engineered
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental
3300010323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG	Environmental
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300011418	Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG	Host-Associated
3300012014	Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M	Environmental
3300012039	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2	Environmental
3300012090	Attine ant fungus gardens microbial communities from Florida, USA - TSFL040 MetaG	Host-Associated
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012895	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2	Environmental
3300012900	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1	Environmental
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental
3300012909	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1	Environmental
3300012913	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2	Environmental
3300012914	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2	Environmental
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012939	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015	Environmental
3300012942	Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG)	Environmental
3300012943	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)	Environmental
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental
3300014254	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2	Environmental
3300014255	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2	Environmental
3300014259	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1	Environmental
3300014263	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1	Environmental
3300014267	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1	Environmental
3300014270	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1	Environmental
3300014271	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2	Environmental
3300014299	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1	Environmental
3300014300	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1	Environmental
3300014301	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1	Environmental
3300014311	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1	Environmental
3300014314	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014487	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG	Environmental
3300014498	Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG	Environmental
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015069	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake	Environmental
3300015085	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)	Environmental
3300015089	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))	Environmental
3300015090	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river)	Environmental
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental
3300018067	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex	Environmental
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental
3300019875	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2	Environmental
3300019881	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2	Environmental
3300019884	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2	Environmental
3300019889	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2	Environmental
3300020005	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2	Environmental
3300020020	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1	Environmental
3300020021	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1	Environmental
3300020022	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2	Environmental
3300020034	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2	Environmental
3300020059	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2	Environmental
3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)	Environmental
3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)	Environmental
3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)	Environmental
3300020154	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_20	Environmental
3300020181	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10	Environmental
3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Environmental
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental
3300021339	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1	Environmental
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental
3300021412	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1	Environmental
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental
3300022880	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6	Environmental
3300022899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6	Environmental
3300022910	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6	Environmental
3300023067	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5	Environmental
3300023102	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5	Environmental
3300023265	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5	Environmental
3300023266	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4	Environmental
3300023268	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6	Environmental
3300023275	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5	Environmental
3300024055	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6	Environmental
3300024347	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)	Environmental
3300024426	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5	Environmental
3300024430	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20	Environmental
3300024996	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_2 (SPAdes)	Engineered
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated
3300025504	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes)	Environmental
3300025535	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)	Environmental
3300025538	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes)	Environmental
3300025552	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)	Environmental
3300025565	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes)	Environmental
3300025568	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 (SPAdes)	Environmental
3300025571	Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-1-D (SPAdes)	Engineered
3300025583	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes)	Environmental
3300025593	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D2 (SPAdes)	Environmental
3300025615	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 (SPAdes)	Environmental
3300025625	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)	Environmental
3300025634	Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)	Environmental
3300025780	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes)	Environmental
3300025798	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D1 (SPAdes)	Environmental
3300025799	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 (SPAdes)	Environmental
3300025814	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes)	Environmental
3300025817	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes)	Environmental
3300025823	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 (SPAdes)	Environmental
3300025854	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)	Environmental
3300025878	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)	Environmental
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental
3300025946	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 (SPAdes)	Environmental
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300025996	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes)	Environmental
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated
3300026051	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes)	Environmental
3300026058	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes)	Environmental
3300026066	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes)	Environmental
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300026107	Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D1_MG (SPAdes)	Environmental
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated
3300027524	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes)	Environmental
3300027636	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq	Environmental
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300028293	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03	Environmental
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Host-Associated
3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Host-Associated
3300028712	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139	Environmental
3300028714	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196	Environmental
3300028721	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355	Environmental
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental
3300028782	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193	Environmental
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental
3300028875	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143	Environmental
3300029987	I_Fen_E3 coassembly	Environmental
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental
3300030499	Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)	Host-Associated
3300030510	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)	Environmental
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental
3300031228	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57	Environmental
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental
3300031274	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30	Environmental
3300031367	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-10	Environmental
3300031411	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)	Environmental
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental
3300032080	Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016	Environmental
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental
3300032896	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4	Environmental
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental
3300034125	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15	Environmental
3300034128	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16	Environmental
3300034147	Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17	Environmental
3300034402	Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 56SNS	Environmental
3300034687	Soil microbial communities from Mojave Desert, California, United States - 1NOC	Environmental
3300034690	Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17	Environmental
3300034781	Biocrust microbial communities from Mojave Desert, California, United States - 31SMC	Environmental
3300034965	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B3_GZOS_CLC_02219370	2124908035	Soil	VDRETARKNMTSGLIAGGFAAAIFALSFVVAFLYIAQ
A5_c1_00677410	2124908044	Soil	VDRETARKNMSAGLFAGAVAATIFALSFVAAFLYIAQ
A_all_C_03187310	2140918007	Soil	VDRETARRNMIGGLMAGGFAAAIFALSFVVALLYIAQ
JGI10213J12805_102195822	3300000858	Soil	MDRETSRANVSAGLVAGGIAAAVFALCFVAAVLYIAS*
JGI11615J12901_144712022	3300000953	Soil	VDRETARSSISAGLLAGGIAAAVFALSFVAAVLYIAS*
JGI10216J12902_1005534354	3300000956	Soil	MDRESSRQSIRAGLVAGGFAAGVFALCFVAAFLYIAQ*
JGI10216J12902_1009152954	3300000956	Soil	VDRETYRRDLRAGLVAGGVAAAIFAICFVVATLYIAS*
JGI10216J12902_1048042253	3300000956	Soil	MDRENARRQLSAGLVTGGIAAGVFALCFVAAFLYIAQ*
JGI10216J12902_1132758232	3300000956	Soil	MDRESARRSLSAGLVTGGIAAGIFALSFVAAFLYIAQ*
JGI10216J12902_1141134402	3300000956	Soil	MDRETARRSMSAGLVAGGIAVGVFALCFVTAFIYIAQ*
JGI10216J12902_1264707612	3300000956	Soil	MDRENARRQISAGLVTGGIAAGVFALSFIAAFLYIAQ*
JGI20186J14852_10018842	3300001405	Arctic Peat Soil	MDRETARKNMVGGLVAGGFAAAIFALAFVVAFLYIAQ*
C688J18823_108152822	3300001686	Soil	VDRETARGNMSAGLVAGGIAAAIFALCFVAAMLYIAS*
JGI24746J21847_100011315	3300001977	Corn, Switchgrass And Miscanthus Rhizosphere	PAVDRETSKRQISAGLVAGGFAAAIFALCFVAATLYIAS*
JGI24740J21852_100227565	3300001979	Corn Rhizosphere	VDRETARKNMAAGLVAAGFATAIFALTFVAALLYIAQG*
JGI24034J26672_100001152	3300002239	Corn, Switchgrass And Miscanthus Rhizosphere	VDRETARRDIGAGLLAAGIAASVFALCFVAAMLYIAS*
Ga0055466_102819112	3300003997	Natural And Restored Wetlands	DRTPAVDRETSRRDMAAGLLAGGIAAAIFALCFLAATLYIAS*
Ga0055450_100000878	3300004001	Natural And Restored Wetlands	LIEIQAMDRELARKNMSTGLVAGGLAVAVFALAFLAAFLYIAVS*
Ga0062593_1020571493	3300004114	Soil	PRSLVKIQLVDRRTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS*
Ga0062591_1004131801	3300004643	Soil	PPVDRERARSNIAAGLLAGGIAAAVFALAFVAAVLYIAS*
Ga0070683_1005213321	3300005329	Corn Rhizosphere	SLVKIQLVDRRTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS*
Ga0068869_1014976082	3300005334	Miscanthus Rhizosphere	VLMDREQARKNMVGGLVAGGFATAIFALAFVAAFLYIAQS*
Ga0070682_1019448141	3300005337	Corn Rhizosphere	DRNPAVDRETARKNMSAGLVAGGLAATVFALCFVAAFLYIAQ*
Ga0070661_1007901091	3300005344	Corn Rhizosphere	RSSGRNPPVDRERARSNIAAGLLAGGIAAAVFALAFVAAVLYIAS*
Ga0070659_1015399162	3300005366	Corn Rhizosphere	RNPPVDRESARSSISAGLLAGGVAAAVFALSFVVAVLYVAS*
Ga0070681_101187235	3300005458	Corn Rhizosphere	GHPPALEAARTDRNPAVDRETARRSMTAGMVAGGFAAVVFALCFIVALLYIAHG*
Ga0073909_104547472	3300005526	Surface Soil	MDRETARRDMTAGLLAGGIAAAVFALCFVAAMLYIASA*
Ga0070672_10000003158	3300005543	Miscanthus Rhizosphere	MDRETARRQLKAGLVAGGIAAGVFALSFVAAFLYIAQ*
Ga0070665_10000286811	3300005548	Switchgrass Rhizosphere	MDRETARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0070665_1000380763	3300005548	Switchgrass Rhizosphere	MDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYVAA*
Ga0070665_1004679012	3300005548	Switchgrass Rhizosphere	VDRETARKNMSAGLVAGGFAAAVFALAFVAAFLYVGAA*
Ga0070665_1012108301	3300005548	Switchgrass Rhizosphere	MDRETARRQMRAGLVTGGIAAGVFALSFVAAFLYIAGS*
Ga0070665_1016838162	3300005548	Switchgrass Rhizosphere	VDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH*
Ga0068855_1010169672	3300005563	Corn Rhizosphere	VDRETARANIGAGLVAGGITAGIFALCFVAAMLYIAS*
Ga0068855_1021392791	3300005563	Corn Rhizosphere	VDRETARRSMTAGLVAGGFAAAVFAACFIVALLYIAH*
Ga0070664_1000525304	3300005564	Corn Rhizosphere	MDRETARRNMKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0070664_1009189181	3300005564	Corn Rhizosphere	VDRERARSNIAAGLLAGGIAAAVFALAFVAAVLYIAS*
Ga0068857_1016413371	3300005577	Corn Rhizosphere	MDRETARRQLKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0068854_10000008259	3300005578	Corn Rhizosphere	MDRETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0068854_1008799722	3300005578	Corn Rhizosphere	MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0068856_1005630382	3300005614	Corn Rhizosphere	VDRETARAKMSAGLLAGGIVAAIFALCFVVAMLYVAS*
Ga0068856_1017879643	3300005614	Corn Rhizosphere	VKIQLVDRRTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS*
Ga0068856_1026423722	3300005614	Corn Rhizosphere	VDRETARRNMTAGLVAGGFAAVVFALCFIVALLYIAHG*
Ga0068852_1000009945	3300005616	Corn Rhizosphere	MDRETARQNMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0068852_1014932113	3300005616	Corn Rhizosphere	MDRQTGKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS*
Ga0068864_10000009075	3300005618	Switchgrass Rhizosphere	VDRETARRDLKAGLLAGGIAAAVFALCFVVATLYIAS*
Ga0068866_100002066	3300005718	Miscanthus Rhizosphere	MDRETARRDMAAGLLAGGVAAAVFALCFLAAMLYIAS*
Ga0068866_100166793	3300005718	Miscanthus Rhizosphere	MDREAARKNMSSGLVAGGLAAAVFALCFVAAFLYIAQ*
Ga0066903_1082273542	3300005764	Tropical Forest Soil	VDRETAKANMTAGLIAGGIAAAVFALTFVIAVLYIAS*
Ga0068851_100031124	3300005834	Corn Rhizosphere	MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYVAG*
Ga0068863_1001212982	3300005841	Switchgrass Rhizosphere	VDRETARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS*
Ga0068863_1005334181	3300005841	Switchgrass Rhizosphere	VDRESAKRNIGAGLVAGGIAAGVFALSFVVAVLYI
Ga0068860_1000854785	3300005843	Switchgrass Rhizosphere	VDRETARAKMNAGLLAGGIAAAIFALCFVAATLYVAS*
Ga0068860_1017741862	3300005843	Switchgrass Rhizosphere	VDRESARASIATGLVAGGVAAAVFALSFVAAVLYIAS*
Ga0075287_10303032	3300005873	Rice Paddy Soil	VDRESARASVSAGLVAGGIAAAIFALSFVAAVLYIAS*
Ga0075287_10374302	3300005873	Rice Paddy Soil	VDRETARAKMSAGLLAGGIAAAIFALCFVAAMLYVAS*
Ga0081540_100055733	3300005983	Tabebuia Heterophylla Rhizosphere	MDRESARNNMVGGLVAGGFAAAIFALAFVAAALYLATS*
Ga0081540_12170422	3300005983	Tabebuia Heterophylla Rhizosphere	MDRESARANMSAGLVAGGIAAAVFALCFVAAMLYIAS*
Ga0075365_107493022	3300006038	Populus Endosphere	VDRERARSNIGAGLLAGAIAAGVFALAFVVAVLYIAS*
Ga0070712_1008448683	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MDRETARRNITGGLVAGGFAAAIFALSFVVALLYIAQ*
Ga0097621_1009178311	3300006237	Miscanthus Rhizosphere	MDREIARKNMGSGLVAGGLAAFVFALCFVAAFLYIAQ*
Ga0074055_118336542	3300006573	Soil	MDRETARRDVAAGLLAGGIAAAVFALCFVAAMLYIAS*
Ga0074059_118443742	3300006578	Soil	VDRETARKNMSAGLVAGGFAAAVFALSFVAAFLYIAQ*
Ga0074048_127165163	3300006581	Soil	VDRETARKNMSAGLAAGGLAAAVFALAFVAAFLYIAQ*
Ga0074062_130269342	3300006606	Soil	VDRETARAKMSAGLLAGGIAAAIFSLCFVAATLYVAS*
Ga0075527_100031114	3300006640	Arctic Peat Soil	VDRETSRRDIRAGLVAGGFAAAVFGLCFVAAMLYIAS*
Ga0075527_100044853	3300006640	Arctic Peat Soil	VDRETSKREMSAGLQAGAFAAAVFALCFVAAMLYIAS*
Ga0075521_104432422	3300006642	Arctic Peat Soil	VDRETARKNMTAGLVAGGIAAAVFALSFVAAFLYIAQ*
Ga0079222_103500313	3300006755	Agricultural Soil	SRNLAVDRETARANMTAGLVAGGIAAAVVALCFVVAMLYVAS*
Ga0079222_103783572	3300006755	Agricultural Soil	MDRETARRNMRAGLIAGGIAAGIFALSFVAAFLYIAQ*
Ga0079222_108103591	3300006755	Agricultural Soil	MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYVAQ*
Ga0079222_120776892	3300006755	Agricultural Soil	MDRESARQSMKAGLVAGGIAAGIFALSFVAAFLYIAS*
Ga0075530_11241521	3300006792	Arctic Peat Soil	TVDRETSRRDMRAGLLAGGTAAAVFALCFVAAMLYIAS*
Ga0079221_114205342	3300006804	Agricultural Soil	MDRDSARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0075421_1000521385	3300006845	Populus Rhizosphere	VDRETARRRISAGFVAGAFAASVFALCFVVAVLYIAQ*
Ga0075430_1002063204	3300006846	Populus Rhizosphere	VDRKTSRANISAGLLAGGIGAAIFALCFVAAVLYIAS*
Ga0075420_1001840893	3300006853	Populus Rhizosphere	VDRETARKNMSAGLVAGGFAAAVFALAFVAAFLYIAQG*
Ga0075425_1000725002	3300006854	Populus Rhizosphere	VDRESARKNMSGGLLLGGFATAIFALSFVAAFLYIAGA*
Ga0075425_1002479355	3300006854	Populus Rhizosphere	PVDRESARANMSAGLLAGGIATAVFALCFVAAMLYIAS*
Ga0075425_1006256373	3300006854	Populus Rhizosphere	VDRDRARSNIATGLLAGAIAAGVFALAFVVAVLYIAS*
Ga0079217_111786832	3300006876	Agricultural Soil	VDRESARRNLSTGFLVGAIAAGVFALSFVAAMLYIAS*
Ga0068865_1015619113	3300006881	Miscanthus Rhizosphere	MDRDSARRQLSAGLLAGGIAAGIFALSFVAAFLYIAA*
Ga0068865_1020778372	3300006881	Miscanthus Rhizosphere	GPPDRNPAVDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ*
Ga0075424_1006200862	3300006904	Populus Rhizosphere	MDRETARRNMRAGLFAGGIAAGIFALSFVAAFLYIAQ*
Ga0074063_129075981	3300006953	Soil	MDRESARKNMAAGLVAGGFAAAVFALCFVAAFLYI
Ga0079219_121220123	3300006954	Agricultural Soil	GLMDRDSARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0102946_100009410	3300007614	Soil	VDRETARKNMSSALVAGGFAAAVFALAFVAAFLYIAQA*
Ga0102946_10056867	3300007614	Soil	VDRETSRRDIRAGLLAGGIAATVFGLSFVAAMLYIAS*
Ga0102949_10054074	3300007757	Soil	VDRETSKREMAAGLQAGAFAAAVFALCFVAAMLYIAS*
Ga0105251_105986561	3300009011	Switchgrass Rhizosphere	VDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG*
Ga0105240_112947402	3300009093	Corn Rhizosphere	VDRETARKNMSSGLVAGGFAAAVFALCFVAAFLYIAQ*
Ga0105245_100382382	3300009098	Miscanthus Rhizosphere	MDRETARRNMRAGLVAGGIAAGIFALSFAAAFLYIAQ*
Ga0105247_1000013145	3300009101	Switchgrass Rhizosphere	VDRESARKNMTAGLVAAGFATGIFALTFVAALFYIAQG*
Ga0115923_101595764	3300009112	Swimming Pool Sandfilter Backwash	VDRETARKNMSAGLVAGGFATAVFALAFVAAFLYIAQG*
Ga0114129_123164122	3300009147	Populus Rhizosphere	VDREQARKNVGAGLMLGAFAAAIFALSFVAALLYIAQ*
Ga0111538_106549554	3300009156	Populus Rhizosphere	DRNRFVDRETARRRISAGFVAGAFAASVFALCFVVAVLYIAQ*
Ga0111538_139787212	3300009156	Populus Rhizosphere	MDRETARRQMRAGLVAGGIAAGIFALSLVAAFLYIAQ*
Ga0075423_103726782	3300009162	Populus Rhizosphere	VDRETSRRDLKAGLLAGGFAAAVFALCFVAATLYIAS*
Ga0105241_101164295	3300009174	Corn Rhizosphere	MDRETARRQMSAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0105242_1000042833	3300009176	Miscanthus Rhizosphere	VDRETARKNMTAGLVAAGLATGIFALTFVAALFYIAQG*
Ga0105242_106321942	3300009176	Miscanthus Rhizosphere	VDRETARRNMTAGLVAGGFAAAVFALCFVVALLYIAH*
Ga0105242_112938363	3300009176	Miscanthus Rhizosphere	AVDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAHG*
Ga0105237_102572203	3300009545	Corn Rhizosphere	MDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAH*
Ga0105238_10000033126	3300009551	Corn Rhizosphere	MDRESARANMSAGLVAGGIAAAIFALCFVAAMLYVAS*
Ga0105238_104762634	3300009551	Corn Rhizosphere	MDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG*
Ga0105249_1000021837	3300009553	Switchgrass Rhizosphere	VDRETAKANMVAGLVAGGIAAAIFALCFVAAMLYIAS*
Ga0105249_107381022	3300009553	Switchgrass Rhizosphere	VDRETARKNLGAGLVAGGLAAAVFALCFVAAFLYIAQ*
Ga0105249_110344531	3300009553	Switchgrass Rhizosphere	TARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS*
Ga0105249_113989911	3300009553	Switchgrass Rhizosphere	ANRGAARTDRNPAVDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG*
Ga0105340_13210082	3300009610	Soil	VDRETTKRSITAGLMAGGVAAAIFALSFVVAMLYIAA*
Ga0126307_100371193	3300009789	Serpentine Soil	VDRETARRSISTGLLAGGIAAAVFALTFVAAVLYIAS*
Ga0126307_109950312	3300009789	Serpentine Soil	VDRESARRNIATGLLAGAIAASVFALSFVAAVLYIAS*
Ga0126307_117083301	3300009789	Serpentine Soil	VDRESARRNIASGLLAGAVAAGVFALAFVAAVLYIAS*
Ga0126313_102726243	3300009840	Serpentine Soil	VDRETARRSISTGLLAGGIAAAVFALTFVVAVLYIAS*
Ga0126313_102800023	3300009840	Serpentine Soil	MDRETARKNMGAGLVAGGFAAAIFALCFVAAFLYIAQ*
Ga0131092_101789963	3300009870	Activated Sludge	MDRETERRSIGGGLVIGAIAAAMFALAFLAAMLYIAP*
Ga0131092_104014992	3300009870	Activated Sludge	MDRESAKQSIGGGLVIGAIAAAMFALAFLAAMLYIAP*
Ga0126305_101047452	3300010036	Serpentine Soil	MDRESARRQLRAGLVTGGIAAGIFALSFVAAFLYIAQ*
Ga0126304_101672263	3300010037	Serpentine Soil	MDRDTARRNMKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0126304_108263202	3300010037	Serpentine Soil	VDRETARSSVSAGLLAGGIAAAVFALSFLAAVLYIAS*
Ga0126309_1000001742	3300010039	Serpentine Soil	VDREHARRNLGQGLILGVVAAGIFALSFFAAMIYIAA*
Ga0126314_110890251	3300010042	Serpentine Soil	GRNPAVDREDARRNIATGLLAGAIAASVFALSFVVAILYIAS*
Ga0126380_108821441	3300010043	Tropical Forest Soil	HPVDRETARRNMSAGLVAGGFAAMIFALCFIVALLYIAH*
Ga0126310_111174762	3300010044	Serpentine Soil	VDRETARRNLSAGLLYGGIAAAVFALCFIASILYIA*
Ga0126311_100031298	3300010045	Serpentine Soil	VDREDARRNIATGLLAGAIAASVFALSFVVAVLYIAS*
Ga0126311_101390892	3300010045	Serpentine Soil	VDRENARRNIVSGLLAGAIAAGVFALAFVVAVLYIAS*
Ga0126311_102581632	3300010045	Serpentine Soil	VDRETSRKNMSAGLVAGGFAAAIFALCFVAAFLYIAQA*
Ga0126311_113233612	3300010045	Serpentine Soil	MDRESARRNISTGLLAGGIAAAIFALSFVAAVLYIAS*
Ga0126382_110542153	3300010047	Tropical Forest Soil	VDRDLAKKNMSAGLVAGGIAAAVFALTFVAAVLYIAS*
Ga0133939_10719453	3300010051	Industrial Wastewater	VDRESARANLISGLVTGGLAALVFALCFVAAALYLATQ*
Ga0126306_101898772	3300010166	Serpentine Soil	MDRETARRNVKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0126306_103957993	3300010166	Serpentine Soil	MDRETARKNMSSGLVAGGFAAAVFALCFVAAFLYIAQ*
Ga0134086_103320472	3300010323	Grasslands Soil	VDRDTARAGISAGLLAGGIAAAVFALSFVAAVLYIAS*
Ga0126376_119242541	3300010359	Tropical Forest Soil	VDRESARKNMSAGLVAGGLATGVFALCFVTALLYIAA*
Ga0126372_124883062	3300010360	Tropical Forest Soil	VDRETARRNMTAGLVAGGFAASVFALCFIVALLYIAH*
Ga0126377_103100663	3300010362	Tropical Forest Soil	MDRETARANMGAGLLAGGIAATVFALCFVVAMLYVAS*
Ga0134125_130490011	3300010371	Terrestrial Soil	KSHFMDREVARKNMSSGLVAGGLAAAVFALCFIAAFLYIAQ*
Ga0134128_114760052	3300010373	Terrestrial Soil	VDRELARRNLSAGLLAGGVAAAVFALCFVAAFIYIAS*
Ga0134128_120689872	3300010373	Terrestrial Soil	VDRELARRNMKGGLLAGGIAVAVFALSFVAAMLYIAS*
Ga0105239_104873712	3300010375	Corn Rhizosphere	MDRETARKNMSAGLVAGGFAAAIFALSFVVAFLYIAQ*
Ga0134126_100332545	3300010396	Terrestrial Soil	VDRETARRNMTAGLVAGGFAAMIFALCFIVALLYIAH*
Ga0134122_129277153	3300010400	Terrestrial Soil	MDRETAKANMTAGLVAGGIAAGIFALTFVVAVLYIAS*
Ga0134123_100836015	3300010403	Terrestrial Soil	VDREASRASIAAGLTAGGIVAAIFALCFVAAVLYIAS*
Ga0134123_101617894	3300010403	Terrestrial Soil	VDRETARAKMSAGLVAGGIAAAVFALCFVAAMLYVAS*
Ga0105246_110246242	3300011119	Miscanthus Rhizosphere	VDRERARSNIATGLLAGAIAAGIFALTFVVAVLYIAS*
Ga0153954_11425211	3300011418	Attine Ant Fungus Gardens	KTGETDRNPPVDRETARRNMTAGLIAGGFSAVVFALCFIVALLWIAH*
Ga0120159_10770783	3300012014	Permafrost	VDRETARRNMSAALVAGGFAAAIFALAFVVALLYIAQ*
Ga0137421_11562822	3300012039	Soil	VDRETSRRDIAAGLLAGGIAAGVFALCFLAAMLYIAS*
Ga0153956_100171311	3300012090	Attine Ant Fungus Gardens	VDRETARRNMTAGLVAGGFAATVFGLCFIVALLYIAHG*
Ga0137365_104258722	3300012201	Vadose Zone Soil	VDRESARANMTAGLLAGGVAAAIFALCFVAAMLYIAS*
Ga0150985_1004172823	3300012212	Avena Fatua Rhizosphere	ETSRRDMAAGLLAGGIAAAIFALCFVAATLYIAS*
Ga0150985_1036695124	3300012212	Avena Fatua Rhizosphere	ETARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0150985_1143968833	3300012212	Avena Fatua Rhizosphere	SDLETARRNMRAGLVAGGIAAGVFALSFVAAFLYIAQ*
Ga0150985_1160190572	3300012212	Avena Fatua Rhizosphere	VDRESARKNMTAGLLAAGFATGIFALTFVAALFYIAQG*
Ga0150985_1209760481	3300012212	Avena Fatua Rhizosphere	ISMDRQTARKNMTGGLVAAGFATAVFALSFVAAFLYIAQG*
Ga0137371_100122717	3300012356	Vadose Zone Soil	VDRETARLNMSAGLLAGGFAAAIFALCFVAAMLYIAS*
Ga0150984_1041217351	3300012469	Avena Fatua Rhizosphere	ETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0150984_1055594613	3300012469	Avena Fatua Rhizosphere	MDRQTARKNMTGGLVAAGFATAVFALSFVAAFLYIAQG*
Ga0150984_1159826191	3300012469	Avena Fatua Rhizosphere	ETARRNMRAGLVAGGIAAGVFALSFVAAFLYIAQ*
Ga0157309_103057332	3300012895	Soil	VDRETARKNMSAGLLAGGLAAAVFALCFIAAFLYIAQ*
Ga0157292_10000006115	3300012900	Soil	MDRETARKNMGAGLVAGGLAAAVFALCFVAALLYIAQ*
Ga0157292_100685762	3300012900	Soil	VDRETAKRNLTAGLIAGGFATAIFALSFVAALLYIAS*
Ga0157283_100008252	3300012907	Soil	MDRETARRNMRAGLVAGGIAAGVFALSFVAAFLYIAQ*
Ga0157286_103101342	3300012908	Soil	MDRETARRNMPAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0157290_100006613	3300012909	Soil	MDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0157298_10000004127	3300012913	Soil	VDRETSKRQISAGLVAGGFAAAIFALCFVAATLYIAS*
Ga0157297_102419682	3300012914	Soil	VDRERARSNIAAGLLAGGIAAGVFALAFVVAVLYIAS*
Ga0157302_102257471	3300012915	Soil	VDRESARRNIATGLIAGGIAAAVFALSFVAAVLYIAS*
Ga0137413_102592882	3300012924	Vadose Zone Soil	VDRESARKNMTAGLVAGGVAAAVFALSFVAAFLYIAQ*
Ga0137413_118040391	3300012924	Vadose Zone Soil	TDRNPAVDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH*
Ga0137404_108630963	3300012929	Vadose Zone Soil	VDRETARANMSAGLLAGGIAAAVFALCFVAAMLYIAS*
Ga0162650_1000003002	3300012939	Soil	MDRESARRQMSAGLLAGGIAAGIFALSFVAAFLYIAA*
Ga0164242_103622932	3300012942	Compost	VDRETARRNMTAGLIAGGFSALVFALCFIVALLYIAHG*
Ga0164242_106123861	3300012942	Compost	VDRETARRNMTAGMIAGGFAAVVFALCFIVALLYIAHG*
Ga0164241_1000152421	3300012943	Soil	MPLIEIPVVDRETARKNMGAGLVAGAFAAVIFALCFVAAFLYIAQ*
Ga0164241_100170165	3300012943	Soil	MDRETARKNMSSGLVAGGIAASVFALCFIAAFLYIAQ*
Ga0164241_100366453	3300012943	Soil	VDRETAKASMSAGLVAGGIATAIFALCFVAAMLYIAS*
Ga0137410_112512742	3300012944	Vadose Zone Soil	MDRETARKNMSSGLVVGGFAAAIFALSFVVAILYIAQ*
Ga0126375_120473341	3300012948	Tropical Forest Soil	MDRERAGRNISAGLVAAGFAAALFALCFVAAFLYIAQ*
Ga0164300_103417292	3300012951	Soil	VDRERARSNIAAGLLAGAIAAGVFALAFVVAVLYIAS*
Ga0164298_101632832	3300012955	Soil	MDRETARRQLGAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0164298_107234042	3300012955	Soil	VDRETARRNMGAGLVAGGLAAAVFALAFVAALLYIAQ*
Ga0164298_114200562	3300012955	Soil	MDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ*
Ga0164298_116385861	3300012955	Soil	VDRERARSNIATGLLAGAIAAGVFALTFVVAVLYIAS*
Ga0164303_110963382	3300012957	Soil	VDRETAKRNMAAGLWAGGIAAAVFALCFVVAFIYIAS*
Ga0164299_100226715	3300012958	Soil	MDRENARRQMKAGLVAGGIAAGIFALSFFAAFLYLAGS*
Ga0164299_107061242	3300012958	Soil	VDRETAKRRISAGFVAGAFAASVFALSFVVAVLYIAQ*
Ga0164299_112373541	3300012958	Soil	RENARRQMKAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0164308_106054551	3300012985	Soil	MDRESARQSMRAGLVAGGIAAGIFALSFVAAFLYIAS*
Ga0164308_116604722	3300012985	Soil	VDRERARSNISTGLLAGSIAAGVFALTFVVAVLYIAS*
Ga0164304_110993551	3300012986	Soil	VDRETARNNMAAGLVAAGFATAIFALAFVVALFYIAQ*
Ga0164307_100346472	3300012987	Soil	MDRESSRAGLKAGLVAGGIAAGIFALSFVAAFLYIAS*
Ga0164307_106079991	3300012987	Soil	RSSGRNPPVDRDRARSNIATGLLAGAIAAGVFALAFVVAVLYIAS*
Ga0164307_109684123	3300012987	Soil	VDRETARKNMAAGLVAGGFAAAIFALAFVAAFLYIAQ*
Ga0164305_112210801	3300012989	Soil	VDRESARRNISTGLLAGGFAAAVFALAFVAAVLYIAS
Ga0157370_101260052	3300013104	Corn Rhizosphere	VDRETSRRDIAAGLVAGGIAAAIFALCFVAATLYIAS*
Ga0157378_100161782	3300013297	Miscanthus Rhizosphere	MDRETARLQMRAGLVAGGIAAGIFALSFVAAFLYIAQ*
Ga0157378_101493384	3300013297	Miscanthus Rhizosphere	MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYIAA*
Ga0157378_110463792	3300013297	Miscanthus Rhizosphere	MDRESARANMSAGLVAGGIATAVFALCFVAAMLYIAS*
Ga0163162_112176872	3300013306	Switchgrass Rhizosphere	MDRQTARKNMSSGLIAGGFAAAIFALCFVAAFLYIAQ*
Ga0157375_1000941411	3300013308	Miscanthus Rhizosphere	MDRETARKNMGAGLVAGGFAAAVFALCFVAAFLYIAQ*
Ga0157375_125146163	3300013308	Miscanthus Rhizosphere	VDRETSRASIAAGLTAGGIVAAIFALCFVAAVLYIAS*
Ga0157375_129544151	3300013308	Miscanthus Rhizosphere	MDRENARANMSAGLVAGGIAAGIFALCFVVAMLYIAS*
Ga0120158_103107502	3300013772	Permafrost	VDRETARRNMSAALVAGGFAAAIFALSFVVALLYIAQ*
Ga0075312_11284461	3300014254	Natural And Restored Wetlands	VDRESARKNMSAGLVAGGLAAAVFALCFVVALLYVAQ*
Ga0075312_11346432	3300014254	Natural And Restored Wetlands	VDRESARRNISTGLLAGGIAASIFALAFVAALLYIAS*
Ga0075320_10349711	3300014255	Natural And Restored Wetlands	VDRETTRANVGAGLSAAGIAVAIFALCFVVAMLYIAS*
Ga0075311_10235982	3300014259	Natural And Restored Wetlands	VDRETARANIGAGLVAGGIAAAVFALCFVAATLYIAS*
Ga0075324_1000003184	3300014263	Natural And Restored Wetlands	MDRETARRNIGAGLMLGGFAAAIFALSFVAAILYIAQ*
Ga0075313_12073042	3300014267	Natural And Restored Wetlands	VDRETARRNMAAGLLAGGIAASVFALCFIAAVLYIAS*
Ga0075325_100006211	3300014270	Natural And Restored Wetlands	VDRETSRANISAGLLAGGIATAIFALCFVAAMLYIAS*
Ga0075325_10151083	3300014270	Natural And Restored Wetlands	VDRETSRRDLRAGLLAGGIAAAVFALCFVVATLYIAS*
Ga0075325_11047962	3300014270	Natural And Restored Wetlands	MDRETSRKDIAAGLIAGGLAAAVFALCFIAATLYIAS*
Ga0075326_12593712	3300014271	Natural And Restored Wetlands	VDRETSKRQITAGLVAGGFAAAVFALCFVAATLYIAS*
Ga0075303_10030192	3300014299	Natural And Restored Wetlands	VDRETTRANVAAGLSAAGIAVTIFALCFVAAMLYVAS*
Ga0075321_10691773	3300014300	Natural And Restored Wetlands	DRNPPVDRETSRRDMTAGLLAGGIAAAIFALCFVAATLYIAS*
Ga0075323_11210382	3300014301	Natural And Restored Wetlands	VDRESARANITAGLVAGGIAVGVFALCFVVAMLYIAS*
Ga0075322_10003443	3300014311	Natural And Restored Wetlands	VDRESARANISAGLVAGGIAATIFALCFVAAMLYIAS*
Ga0075316_10210651	3300014314	Natural And Restored Wetlands	VDRETARANISAGLVAGGIAAAIFALCFVAAMLYIAS*
Ga0163163_102783874	3300014325	Switchgrass Rhizosphere	VDRESARASISAGLVAGGVAAAVFALSFVAAVLYIAS*
Ga0163163_102890462	3300014325	Switchgrass Rhizosphere	VDRETAKRNLTAGLLAGGIATAVFALSFVAALFYIAS*
Ga0163163_115936312	3300014325	Switchgrass Rhizosphere	VDRETARRDLAAGLLAGGIAAGVFTLCFVVAVLYIAS*
Ga0157380_1000134312	3300014326	Switchgrass Rhizosphere	VDRETARSSISAGLLAGGIAAAVFALSFLAAVLYIAS*
Ga0182000_100084002	3300014487	Soil	VDRETSRRDIRAGLLAGGFAAAVFALCFVAATLYIAS*
Ga0182019_101039384	3300014498	Fen	VDRETARKNMTGGLVAGGFAAAIFALAFVAAFLYIAQ*
Ga0157377_102065522	3300014745	Miscanthus Rhizosphere	VDRETARKNMSSGLVAGGFAAAVFALCFVVAFLYIAQ*
Ga0157379_100885275	3300014968	Switchgrass Rhizosphere	VDRETAKGNMVAGLVAGGIAAAVFALCFVAAMLYIAS*
Ga0157379_107121001	3300014968	Switchgrass Rhizosphere	PDRNPTVDRETARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS*
Ga0157376_100781253	3300014969	Miscanthus Rhizosphere	MDRETARRNMRAGLVAGGVAAGIFALSFVAAFLYIAQ*
Ga0167633_1145153	3300015069	Glacier Forefield Soil	VDRETARKNMTAGLVAGGFAAGVFALCFIAAFLYIAQS*
Ga0167632_10218612	3300015085	Glacier Forefield Soil	VDRETSRRDIAAGLMAGGIAAAIFALCFVAAALYIAQ*
Ga0167643_10311211	3300015089	Glacier Forefield Soil	VDRETARRNMTAGLVAGGFAAMVFALCFIVALLSIAH*
Ga0167634_10036102	3300015090	Glacier Forefield Soil	MDRETSRRNMAAGLVAGGIAAAIFALCFVAATLYIAS*
Ga0173480_109311172	3300015200	Soil	VDRETARRRIGAGFVAGAFAASVFALCFVVAVLYIAQ*
Ga0137412_109627011	3300015242	Vadose Zone Soil	VDREVARKNMSAGLLAGGFAVAIFALSFVAAFLYIAQ*
Ga0137412_110388311	3300015242	Vadose Zone Soil	VDRESARKNMTAGLLAAGFATGIFALTFVAALLYIAQG*
Ga0132258_110611575	3300015371	Arabidopsis Rhizosphere	VDRETARKNMSAGLVAGGFAAAIFALCFVAAFLYVAQ*
Ga0163161_100084462	3300017792	Switchgrass Rhizosphere	MDRETARKNMGSGLMVGGFAAAIFALCFVAAFLYIAQ
Ga0187825_101253592	3300017930	Freshwater Sediment	MDRQTARANMTAGLVAGGIAAAIFALSFVVAVLYIAS
Ga0190266_100745562	3300017965	Soil	VDRETARKNMSAGLVAGGFAAAVFALAFVAAFLYIAQG
Ga0184611_12178182	3300018067	Groundwater Sediment	MDRETARRNMKAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0184618_101592152	3300018071	Groundwater Sediment	VDRDTARRNIGAALLAGAIAASVFALSFVVAVLYIAS
Ga0190265_1000006320	3300018422	Soil	MDRETARRNMTSALVAGGIAAAIFALCFVAATLYIAS
Ga0190265_100548134	3300018422	Soil	VDRETSRKDIGAGLLAGAIAAGVFALSFLAAMLYIAS
Ga0190265_100871033	3300018422	Soil	VDRETARRNLTSALVLGGVAATIFALCFVAATLYIAS
Ga0190265_101484504	3300018422	Soil	MDRETARRSMSAGLVAGGIAVGVFALCFVTAFIYIAQ
Ga0190272_100110784	3300018429	Soil	VDRESAKQNMSAGLLAGGIAASVFALCFVAAMLYIAS
Ga0190272_101477314	3300018429	Soil	VDRETAKANMSAGLLAGGIAATVFALCFVAAMLYIAS
Ga0190272_102524732	3300018429	Soil	MDRETARKNMAGGLVAAGFATAVFALCFVAAFLYVAQ
Ga0190272_103870942	3300018429	Soil	MDRETARKNMSTGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0066655_101639671	3300018431	Grasslands Soil	MDRETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0190275_1000030414	3300018432	Soil	MDRENARRQISAGLITGGIAAGVFALCFVTAFVYIAG
Ga0190275_1000349913	3300018432	Soil	VDRETARKNMSSGLVAGGFAAAVFALCFVAAFLYIAQ
Ga0190275_113002422	3300018432	Soil	VDRETARRNLSSGLLYGGIAAAIFALCFLASILYIA
Ga0190275_117588712	3300018432	Soil	VDRDTARRNLSAGLLYGGIAAAIFGLCFIASILYIA
Ga0190275_120095332	3300018432	Soil	VDRETARKNMSAGLVAGGFAAAVFALCFVAAFLYIAQ
Ga0190269_1000106711	3300018465	Soil	MDRETARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0190268_102257373	3300018466	Soil	VDRETARRNLTAGLLYGGIAAAVFALCFIASILYIA
Ga0190270_100262363	3300018469	Soil	VDRETARRNMTAGLLYGGIAAAVFALCFIASILYIA
Ga0190270_100719191	3300018469	Soil	MDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA
Ga0190270_105604053	3300018469	Soil	VDRELAKRNMSAGLLAGAIAAALFALAFLAAVLYIAS
Ga0190270_109380551	3300018469	Soil	VDRETARKNMSSGLFAGAFVAAVFALSFVAAFLYIAQ
Ga0190270_120338862	3300018469	Soil	VDRETARRNISAGLLAGGIAATIFALSFVAAVLYIAS
Ga0190274_1000003731	3300018476	Soil	VDRETSRKNIGAGLLAAGLAAGVFALCFVAALLYIAQ
Ga0190274_1000064723	3300018476	Soil	VDRETARANIGAGLVAGGIAAAIFALCFVAAMLYIAS
Ga0190274_100652042	3300018476	Soil	VDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYVAQ
Ga0190274_102795271	3300018476	Soil	PCLPDRNPPVDRETAKRDMGAGLLAGGIAAGVFALCFVAAMLYIAS
Ga0190271_10000013107	3300018481	Soil	VDRELAKRNLSSGLLAAAIAAALFALAFLAAVLYIAS
Ga0190271_1000015737	3300018481	Soil	VDRETARKNMAAGLVAAGFATAIFALAFVVALFYIAQ
Ga0190271_100236579	3300018481	Soil	MDRENARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0190271_100373265	3300018481	Soil	MDRESARRQLSAGLLAGGIAAGIFALSFVAAFLYIAA
Ga0190271_109123052	3300018481	Soil	MDRENARRQMKAGLVAGGIAAGIFALSFVAAFLYIAGS
Ga0190273_1000001879	3300018920	Soil	MDRETARRNMRAGLVAGGIAAGVFALAFVAAFLYIAQ
Ga0190273_102120133	3300018920	Soil	MDRETARRQMRAGLVTGGIAAGIFALSFVAAFLYIAQ
Ga0190273_104970743	3300018920	Soil	MDRETARRNMKAGLLAGGIAAGVFALSFVAAFLYIAQ
Ga0190273_113854352	3300018920	Soil	MDRESSRRNLSAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0190264_102509962	3300019377	Soil	VDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0190264_106149102	3300019377	Soil	VDRESARKNMSAGLVAGGFAAAIFALAFVAAFLYIAQG
Ga0193701_11004032	3300019875	Soil	MDRETARRQMKAGLVTGGIAAGIFALSFVAAFLYIAQ
Ga0193707_10881641	3300019881	Soil	VDREAARKNMSAGLVAAGLAAAVFALCFIAAFLYIAQ
Ga0193741_10164873	3300019884	Soil	VDRETSKANISAGLMAGGIAAAVFALCFVAAMLYIAS
Ga0193743_10018909	3300019889	Soil	VDRETARKNMGAGLVAGGLAAAVFALCFVVAFLYIAQ
Ga0193697_10694862	3300020005	Soil	MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0193738_10344774	3300020020	Soil	MDRETARKNMGAGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0193726_10476004	3300020021	Soil	VDRESARKNMTAGLVAGGVAAAVFALSFVAAFLYIAQ
Ga0193726_10504771	3300020021	Soil	PCLPDRNPPVDRETSRRDMAAGLLAGGIAAAIFALCFLAATLYIAS
Ga0193733_11023603	3300020022	Soil	VDRETARKNMAGGLAAGGFAAAIFALSFVVALLYIAQ
Ga0193753_100761774	3300020034	Soil	VDRETARKNMSAGLLVGSFAAAIFALSFIVAFLYIA
Ga0193753_101161834	3300020034	Soil	VDRETARRNMTAGLVAGGFAAVVFALCFIVALLYIAH
Ga0193745_10247863	3300020059	Soil	MDRETSRRDMAAGLVAGGIAAAIFALCFVAATLYIAS
Ga0197907_108708753	3300020069	Corn, Switchgrass And Miscanthus Rhizosphere	DRNQGVDRETARRNMTAGLVAGGFAAAIFALCFIVALLWIAH
Ga0206356_106666275	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	MDRETARRNLSAGLLAGGIATAVFALCFVAGFLYIAQ
Ga0206351_104083911	3300020077	Corn, Switchgrass And Miscanthus Rhizosphere	RETARRSMTAGLVAGGFAAMVFAACFIVALLYIAH
Ga0196965_11662142	3300020154	Soil	VDRETARKNMSAGLVAGAFAASVFSLAFVAALLYIAQ
Ga0196958_1000219810	3300020181	Soil	MDRESARRSLSAGLVTGGIAAGIFALSFVAAFLYIAQ
Ga0196958_101435983	3300020181	Soil	MDRETARRSMSAGLVAGGIAAGVFALCFVTAFIYIAQ
Ga0196958_102122462	3300020181	Soil	MDRENARRQLSAGLVTGGIAAGVFALCFVAAFLYIAQ
Ga0154015_15409692	3300020610	Corn, Switchgrass And Miscanthus Rhizosphere	MDRQSARNSMRAGLIAGGIAAGIFALSFVAAFLYIAS
Ga0179596_106382891	3300021086	Vadose Zone Soil	VDRETARRNMTAGLVAGGFAALVFALCFIVALLYIAH
Ga0193706_10070935	3300021339	Soil	VDRETVRKNIGAGLFAGALAAAVFALCFVAAFLYVA
Ga0193706_10123902	3300021339	Soil	VDRETARKNMSGALVVGGLAAAVFALCFVAAFLYIAQ
Ga0193706_10530224	3300021339	Soil	MDRETSRKNMTGGLVAAGFATAIFALSFVAAFLYIAQG
Ga0193699_101195042	3300021363	Soil	MDRETARRQMKAGLVAGGIAAGVFALSFVAAFLYIAA
Ga0210393_102957003	3300021401	Soil	MDRETARKNMIGGLMAGGFAAAIFALAFVVAFLYIAQ
Ga0210397_100855662	3300021403	Soil	VDRETARRNMTAGLVAGGFAATVFALCFIVALLYVAH
Ga0193736_10579872	3300021412	Soil	VDRETARKNMGAGLFAGAFVAAIFALCFIVAFLYIAQ
Ga0182009_106417612	3300021445	Soil	VDRETARRNLTAGLVAGGIAAAVFALSFVAAVLYIAS
Ga0210409_100100533	3300021559	Soil	VDRETARRKMSAGLVAGGLAAAVFALSFLVALLYIAQ
Ga0126371_109362242	3300021560	Tropical Forest Soil	MDRESARNSMRAGLIAGGIAAGIFALSFVAAFLYLAS
Ga0222622_100490225	3300022756	Groundwater Sediment	VDRETARRNMIGGLVAGGFAAAIFALSFVVALLYIAQ
Ga0222622_106037691	3300022756	Groundwater Sediment	GRNPPVDRESARRNMGAGLVAGGIAAGIFALSFLVAVLYIAS
Ga0247792_10111583	3300022880	Soil	MDRETARRNMRAGLVTGGIAAGIFALSFVAAFLYIAQ
Ga0247795_100012813	3300022899	Soil	MDRETARRNLSAGLVTGGIAAGVFALCFVAAFLYIAQ
Ga0247768_100001626	3300022910	Plant Litter	MDRETARQNMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0247743_10020444	3300023067	Soil	MDREQARASVSAGLVAGLVAAAVFALCFVAAMLYIAS
Ga0247754_10007523	3300023102	Soil	VDRETAKRNISGGLLAGGIAAGVFALCFVVAMLYIAS
Ga0247780_100144310	3300023265	Plant Litter	MDRETARRNISSGLFAGALAASVFALCFVAALLYIAQ
Ga0247789_10105513	3300023266	Soil	MDRETARRSLRAGLVAGGIAAGVFALAFVTAFLYIAQ
Ga0247789_10565552	3300023266	Soil	MDRETARRSMSAGLVAGGIAVGVFALCFVTAFVYIAQ
Ga0247765_10053252	3300023268	Plant Litter	MDRETARRQMSAGLVAGGIAAGIFALSFVAAFLYIAA
Ga0247776_1000028111	3300023275	Plant Litter	MDRETARRQMGAGLVAGGIAAGIFALSFVAAFLYIAA
Ga0247794_100635502	3300024055	Soil	MDRETARTNMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0179591_11808833	3300024347	Vadose Zone Soil	VDRETARKNMSAGLLAGGLAAAVFALAFVAALLYIAQ
Ga0196960_100005794	3300024426	Soil	MDRETARKNMSAGLTAGGIAAGVFALCFVTAFIYIAG
Ga0196960_100637853	3300024426	Soil	MDRESARKNISAGLVAGGIAVGIFALAFVTAFIYIAQ
Ga0196962_1000025915	3300024430	Soil	VDRETARKNMGAGLLAGGIAAAVFALSFVAALLYIA
Ga0209916_10009511	3300024996	Wastewater Bioreactor	VDRETARRNMTAGLVAGGFAAVVFALCFIVALLYIAHG
Ga0207656_100174124	3300025321	Corn Rhizosphere	MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYVAG
Ga0208356_100000577	3300025504	Arctic Peat Soil	MDRETARKNMVGGLVAGGFAAAIFALAFVVAFLYIAQ
Ga0207423_10098371	3300025535	Natural And Restored Wetlands	SRTRAVDRETTRANVAAGLSAAGIAVTIFALCFVAAMLYVAS
Ga0210132_10001392	3300025538	Natural And Restored Wetlands	VDRETTRANVAAGLSAAGIAVTIFALCFVAAMLYVAS
Ga0210142_10065853	3300025552	Natural And Restored Wetlands	MDRETARRNISSGLLTGGIAAAVFALCFVAAMLYVAS
Ga0210110_10026504	3300025565	Natural And Restored Wetlands	VDRETSRRDIRAGLVAGGFAAAVFGLCFVAAMLYIAS
Ga0210110_10108555	3300025565	Natural And Restored Wetlands	PGLIEIRLVDRETSRRDMAAGLLAGGIAAAIFALCFVAATLYIAS
Ga0210095_10171204	3300025568	Natural And Restored Wetlands	VDRETSKREMAAGLQAGAFAAAVFALCFVAAMFYIAS
Ga0207874_10608011	3300025571	Ionic Liquid And High Solid Enriched	VDRETARKNMATGLAAGGFAAAIFALTFVAAILYIA
Ga0210085_100059319	3300025583	Natural And Restored Wetlands	MDRELARKNMSTGLVAGGLAVAVFALAFLAAFLYIAVS
Ga0210096_11982002	3300025593	Natural And Restored Wetlands	VDRETSRRDISAGLMAGGIAATIFALCFVAATLYIAS
Ga0210086_10131822	3300025615	Natural And Restored Wetlands	MDRETARRNVVAGLLTGGIAAAIFALCFVAAMLYIAS
Ga0210086_11010453	3300025615	Natural And Restored Wetlands	MDRETARRNMSSGLLTGGIAAAVFALCFVAAMLYVAT
Ga0208219_10031387	3300025625	Arctic Peat Soil	MDRETARRNMTTGLMTGGFAAAIFALSFVVAFLYIAQ
Ga0208589_11008342	3300025634	Arctic Peat Soil	VDRETARKNMTAGLVAGGLAATVFALCFIVALLYIAH
Ga0210100_10002307	3300025780	Natural And Restored Wetlands	MDRESARAKMSAGLVAGGIAAGIFALCFVVAMLYIAS
Ga0210100_10002519	3300025780	Natural And Restored Wetlands	MDRETARRNIGAGLMLGGFAAAIFALSFVAAILYIAQ
Ga0210063_100005912	3300025798	Natural And Restored Wetlands	VDRETARKNMSSALVAGGFAAAVFALAFVAAFLYIAQA
Ga0210122_10090575	3300025799	Natural And Restored Wetlands	VDRESSRQDIRAGLVAGGFAAAVFGLCFVAAMLYIAS
Ga0210101_100019611	3300025814	Natural And Restored Wetlands	VDRETSRRDIGAGLTAGAFAAAVFALCFVAAMLYIAS
Ga0210101_100033913	3300025814	Natural And Restored Wetlands	MDRETAKRDLTAGLVVGGIAAGVFALCFVTAMLYIAS
Ga0210101_11047642	3300025814	Natural And Restored Wetlands	VDRELAKRNMSGGLIVGGLAAAVFALSFVAAMLYIAS
Ga0210144_100014827	3300025817	Natural And Restored Wetlands	MDRETARRELTAGLVTGGIAAGVFALCFVAAMLYIAS
Ga0210144_100028028	3300025817	Natural And Restored Wetlands	VDRETARRDLTAGLVAGGIAAGVFALCFVTAMLYIAS
Ga0210144_11294793	3300025817	Natural And Restored Wetlands	VDRETAKRNVSAGLLAGGIAASIFALTFVAAMLYIAS
Ga0210123_10498132	3300025823	Natural And Restored Wetlands	VDRESAQGNIGAGLLAGGIAVGVFALAFVVAVLYIAS
Ga0210123_11224262	3300025823	Natural And Restored Wetlands	VDRETSRRDISAGLMAGGIAAAIFALCFVAATLYIAS
Ga0209176_100167802	3300025854	Arctic Peat Soil	VDRETSKREMSAGLQAGAFAAAVFALCFVAAMLYIAS
Ga0209584_102772282	3300025878	Arctic Peat Soil	VDRETARKNMTAGLVAGGIAAAVFALSFVAAFLYIAQ
Ga0207692_101267872	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MDRETARRNIGSGLMLGGFAAAIFALSFVAALLNIAQ
Ga0207642_10000005198	3300025899	Miscanthus Rhizosphere	VDRETARAKMSAGLLAGGIVAAIFALCFVVAMLYVAS
Ga0207642_1000073711	3300025899	Miscanthus Rhizosphere	MDRETARRDMAAGLLAGGVAAAVFALCFLAAMLYIAS
Ga0207642_100193484	3300025899	Miscanthus Rhizosphere	MDREAARKNMSSGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0207685_1000001239	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	VDRETARAKMSAGLLAGGIAAAIFALCFVAATLYVAS
Ga0207699_111332202	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	VDRETAKRNMAAGLLAAGIAAVVFALCFVAAFMYIAS
Ga0207643_106637341	3300025908	Miscanthus Rhizosphere	TGLSSRNPAMDRETARRNMTGGLVAGGFAAAIFALTFVVALLYIAQ
Ga0207654_106504291	3300025911	Corn Rhizosphere	VDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG
Ga0207707_100598175	3300025912	Corn Rhizosphere	VDRETARANIGAGLVAGGITAAIFALCFVAAMLYIAS
Ga0207707_110954482	3300025912	Corn Rhizosphere	VDRERARSNIAAGLLAGAIAAGVFALAFVVAVLYIAS
Ga0207693_1001082511	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MDRETARRQLKAGLVAGGIAAGVFALSFVAAFLYIAQ
Ga0207693_112129942	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	VDRELARRNLSAGLLAGGVAAAVFALCFVAAFIYIAS
Ga0207657_101666532	3300025919	Corn Rhizosphere	MDRESARQSMRAGLVAGGIAAGIFALSFVAAFLYIAS
Ga0207694_10000012127	3300025924	Corn Rhizosphere	MDRESARANMSAGLVAGGIAAAIFALCFVAAMLYVAS
Ga0207694_104965412	3300025924	Corn Rhizosphere	VDRQTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS
Ga0207659_1000005535	3300025926	Miscanthus Rhizosphere	MDRETARRQMRAGLIAGGVAAGIFALSFVAAFLYIAQ
Ga0207687_100209552	3300025927	Miscanthus Rhizosphere	MDRETARRNMRAGLVAGGIAAGIFALSFAAAFLYIAQ
Ga0207700_10000003179	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MDRESARQSMRAGLVAGGIAAAIFALSFVAAFLYIAS
Ga0207664_1001553510	3300025929	Agricultural Soil	MDRESARRNLRAGLLAGGIAAGIFALSFVAAFLYLAQ
Ga0207686_103394302	3300025934	Miscanthus Rhizosphere	VDRETARRNMTAGLVAGGFAAAVFALCFVVALLYIAH
Ga0207669_101072934	3300025937	Miscanthus Rhizosphere	VDRERSRSNIATGLLAGGIAAGVFALAFVVAVLYIAS
Ga0207704_102453472	3300025938	Miscanthus Rhizosphere	VDRETARKNMGAGLVAGGIAAAVFALCFVAAFLYIAQ
Ga0207704_112536473	3300025938	Miscanthus Rhizosphere	MDRDSARRQLSAGLLAGGIAAGIFALSFVAAFLYIAA
Ga0207665_114374242	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	VDRETARRNMIGGLVAGGFAAAIFALSFVVALLYVAQ
Ga0210126_1004642	3300025946	Natural And Restored Wetlands	VDRETARAGISAGLLAGGIAAAVFALSFVAAVLYIAS
Ga0207667_106170932	3300025949	Corn Rhizosphere	VDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAH
Ga0207667_107003162	3300025949	Corn Rhizosphere	VDRETARANIGAGLVAGGITAGIFALCFVAAMLYIAS
Ga0207712_10000027230	3300025961	Switchgrass Rhizosphere	VDRETAKANMVAGLVAGGIAAAIFALCFVAAMLYIAS
Ga0207712_110452902	3300025961	Switchgrass Rhizosphere	VDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH
Ga0207712_112139842	3300025961	Switchgrass Rhizosphere	VDRETARKNLGAGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0207658_101039473	3300025986	Switchgrass Rhizosphere	MDRQTARKNMSSGLVAGGFAAAIFALCFVAAFLYIAQ
Ga0207658_104862841	3300025986	Switchgrass Rhizosphere	ARTDRNPAVDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG
Ga0207658_105327091	3300025986	Switchgrass Rhizosphere	MDRETARRQMRAGLVTGGIAAGVFALSFVAAFLYIAG
Ga0208777_10107612	3300025996	Rice Paddy Soil	VDRESARASVSAGLVAGGIAAAIFALSFVAAVLYIAS
Ga0208777_10132663	3300025996	Rice Paddy Soil	VDRETARAKMSAGLLAGGIAAAIFALCFVAAMLYVAS
Ga0207677_1000364810	3300026023	Miscanthus Rhizosphere	VDRESARASISASLVAGGIAAAVFALSFVAAVLYIAS
Ga0207677_100090014	3300026023	Miscanthus Rhizosphere	MDRETARRQLKAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0208911_10002613	3300026051	Natural And Restored Wetlands	VDRETSRANISAGLLAGGIATAIFALCFVAAMLYIAS
Ga0208911_10049162	3300026051	Natural And Restored Wetlands	VDRETSRRDLRAGLLAGGIAAAVFALCFVVATLYIAS
Ga0208421_10186762	3300026058	Natural And Restored Wetlands	VDRESARANITAGLVAGGIAVGVFALCFVVAMLYIAS
Ga0208290_10000396	3300026066	Natural And Restored Wetlands	VDRESARANISAGLVAGGIAATIFALCFVAAMLYIAS
Ga0207678_101187852	3300026067	Corn Rhizosphere	MDRETSRRDMAAGLMAGGIAAAIFALCFVAATLYIAS
Ga0207678_103471123	3300026067	Corn Rhizosphere	VDRERARRSIGAGLLAGGIAAGVFALAFVVAVLYIAS
Ga0207708_105249473	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MDRESARKNMSSGLVAGALAASVFALCFVAAFLYIAQ
Ga0207641_100760275	3300026088	Switchgrass Rhizosphere	VDRETARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS
Ga0207676_10000016289	3300026095	Switchgrass Rhizosphere	VDRETARRDLKAGLLAGGIAAAVFALCFVVATLYIAS
Ga0209950_10050583	3300026107	Soil	VDRETSKREMAAGLQAGAFAAAVFALCFVAAMLYIAS
Ga0207683_101967421	3300026121	Miscanthus Rhizosphere	VDRETARAKMSAGLLAGGIAAAIFALCFVATMLYVAS
Ga0207698_115933502	3300026142	Corn Rhizosphere	MDRETARANIGAGLVAGGIVAAVFALCFVAAMLYIAS
Ga0207698_117210771	3300026142	Corn Rhizosphere	LVDRQTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS
Ga0207698_122656821	3300026142	Corn Rhizosphere	VDRESARASISAGLVAGGVAAAVFALSFVAAVLYVAS
Ga0208998_100000831	3300027524	Forest Soil	VDRETARKSISSGLVAGGFAAAVFALCFVVALLYIAQ
Ga0214469_10028973	3300027636	Soil	VDRETAKSSISTGMVTGGIAAAIYALCFVAAIFYIAS
Ga0214469_11457662	3300027636	Soil	VDRETARRNISGGLLAGAIAAAVFALCFVAAMLYIAS
Ga0209178_13582262	3300027725	Agricultural Soil	MDRDSARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA
Ga0209074_104474442	3300027787	Agricultural Soil	MDRETARRNMRAGLIAGGIAAGIFALSFVAAFLYIAQ
Ga0209382_100235347	3300027909	Populus Rhizosphere	VDRETARRRISAGFVAGAFAASVFALCFVVAVLYIAQ
Ga0247662_10649792	3300028293	Soil	MDRETARRNMTGGLVAGGFAAAIFALTFVVALLYIAQ
Ga0268266_100155883	3300028379	Switchgrass Rhizosphere	MDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYVAA
Ga0268266_111990423	3300028379	Switchgrass Rhizosphere	AVDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH
Ga0268265_124307811	3300028380	Switchgrass Rhizosphere	DRETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0268264_1000119111	3300028381	Switchgrass Rhizosphere	VDRETARAKMNAGLLAGGIAAAIFALCFVAATLYVAS
Ga0268264_121379172	3300028381	Switchgrass Rhizosphere	VDRESARASIATGLVAGGVAAAVFALSFVAAVLYIAS
Ga0265337_10012566	3300028556	Rhizosphere	VDRETARRNMTAGLVAGGFAAGMFALSFIVALLYIAQ
Ga0265337_11995932	3300028556	Rhizosphere	VDRETARKNMTGGLVAGGFAAAIFALAFVAAFLYIAQ
Ga0265326_101564832	3300028558	Rhizosphere	VDRETARKNMVGGLVAAGFAAAIFALAFVAAFLYIAQ
Ga0307285_1000000427	3300028712	Soil	MDRENARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0307309_100561962	3300028714	Soil	MDRESARANMSAGLVAGGLATAVFALCFVAAMLYIAS
Ga0307315_100576602	3300028721	Soil	MDRETARRNMRAGLVAAGFAAGIFALSFVAAFLYIAQ
Ga0307280_1000002450	3300028768	Soil	MDRESARRQMRAGLVAGGIAAGVFALSFVAAFLYIAQ
Ga0307280_102522381	3300028768	Soil	DRESARRNIATGLLAGGIAAGIFALAFVAAVLYIAS
Ga0307280_102601032	3300028768	Soil	VDRERARSNIATGLLAGGIAAAVFALAFVAAVLYIAS
Ga0307306_100000445	3300028782	Soil	MDRETARRNMSAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0307503_1000013227	3300028802	Soil	VDRETARANMAAGLTAGGIAAAVFALCFVAAMLYIAS
Ga0307503_106297342	3300028802	Soil	MDREHAKRSMSAGLLAGAFAAAIFALAFLAAVLYVAS
Ga0307289_100356262	3300028875	Soil	VDRETARRNMIGGLVAGGFATAIFALSFVVALLYIAQ
Ga0311334_118209461	3300029987	Fen	MDRESARRNLGSGLVIGAIAAGIFALSFIVATLYIASA
Ga0299907_102030873	3300030006	Soil	MDRETARRNLGSGLLIGSFAAFVFALSFLTAMLYIAQ
Ga0268259_100923952	3300030499	Agave	MDRENARRNMSAGLVAGGLAAAVFALCFVAAFLYIAQ
Ga0268243_10068652	3300030510	Soil	VDRETSRRDIRAGLLAGGFAAAVFALCFVAATLYIAS
Ga0307499_100052365	3300031184	Soil	VDRETARRDIGAGLLAGGIAAGVFALCFVAAMLYIAS
Ga0307497_104891731	3300031226	Soil	VDRETARAKMSAGLLAGGIAAAIFALCFVAATLYIAS
Ga0299914_100001918	3300031228	Soil	VDRESARSSVAAGLLAGGVAAGVFALCFVAAMLYIAS
Ga0299914_100106435	3300031228	Soil	VDRESTKQNISAGLLAGAFAAAIFALSFIAAMLYIAS
Ga0299913_100932942	3300031229	Soil	VDRETSKRSMTTGLLAGGVAAAVFALTFLAATLYIAT
Ga0307442_11321322	3300031274	Salt Marsh	MDRETARRELTAGLVAGGIAAAVFALCFVTAVLYIA
Ga0307440_10077222	3300031367	Salt Marsh	VDRETSRRDITAGLLAGGIAAAIFALCFVAATLYIAS
Ga0307440_11434741	3300031367	Salt Marsh	MDRETARKNMVGGLVAGGFATAIFALAFVAAFLYVAQ
Ga0102761_121736121	3300031411	Soil	VDRETARRNMFAGMAAAGFAAVVFALCFIVALLYIAH
Ga0307468_1010289471	3300031740	Hardwood Forest Soil	MDRESARRQMSAGLLAGGIAAGIFALSFVAAFLYIAA
Ga0315297_103540972	3300031873	Sediment	VDRESAKRNIGGGLAFGAFAAGMFALAFVAAMLYIAP
Ga0308175_10000037135	3300031938	Soil	MDRELARKNMRAGLVAGGLATAVFALAFVAAVLYIAQ
Ga0308176_104879912	3300031996	Soil	VDRETARRDLTAGLVAGGIAAAIFALCFVAATLYIAS
Ga0307416_1030640293	3300032002	Rhizosphere	ELRTMDRETARRSISAGLVAGGIAAGVFALCFVTAFIYIAQ
Ga0308173_118524212	3300032074	Soil	MDRETARRQMRAGLVVGGIAAGIFALSFVAAFLYIAQ
Ga0326721_1000005125	3300032080	Soil	MDRETARRSIGAGLVAGGIAAGVFALCFVTAFIYIAQ
Ga0307415_1006494602	3300032126	Rhizosphere	MDRETARRSISAGLVAGGIAAGVFALCFVTAFIYIAQ
Ga0315912_112016592	3300032157	Soil	MDRESARRQLSAGLVAGGIAAGVFALSFVAAFLYIAA
Ga0307470_100087813	3300032174	Hardwood Forest Soil	VDRETSRRDIGAGLLAAGIAAGIFAICFVVATLYIAS
Ga0307470_110801952	3300032174	Hardwood Forest Soil	MDRESARRQLKAGLVAGGIAAGIFALSFVAAFLYIAQ
Ga0307471_1001787765	3300032180	Hardwood Forest Soil	DRNLAVDRETARRKVSAGLVAGGFAAAVFALSFVVALLYIAQ
Ga0307472_1011899872	3300032205	Hardwood Forest Soil	MDRESSRAGIKAGLVAGGIAAGIFALSFVAAFLYIAS
Ga0307472_1014283652	3300032205	Hardwood Forest Soil	VDRETAKSNMTAGLLAGGVAAAIFALSFVVAVLYIAS
Ga0335070_1000009980	3300032829	Soil	VDRETARKNMVGGLVAGGFAAAIFALTFVAAFLYIAAS
Ga0335070_101091475	3300032829	Soil	VDRDLARKNMVGALVAGGFAAAIFALCFVAALLYIAQ
Ga0335070_101907394	3300032829	Soil	MDRETARRNMAGGLVAAGFATAIFALSFVAAFLYIAQG
Ga0335070_102384972	3300032829	Soil	MDRETARANMSAGLLAGGIAAAIFALCFVAAMLYIAS
Ga0335075_104667183	3300032896	Soil	VDRETARKNMSAGLVAGGIAAAVFALAFVAAFLYVGAA
Ga0335075_112936182	3300032896	Soil	VDRETARRNMTAGLVAGGFAAAVFALSFIVALLYIAH
Ga0335083_10000084100	3300032954	Soil	VDRETAHKGMTAGLIAGGFSALVFALCFIVALLYIAH
Ga0335083_113366322	3300032954	Soil	MDRELARKNIRAGLIAGGVAAAVFALCFAVAFLYIAS
Ga0326726_100280346	3300033433	Peat Soil	MDRETARQRLSAGLLAGGIAAGVFALCFIVATLYIAS
Ga0370484_0042838_906_1019	3300034125	Untreated Peat Soil	VDRETARRNMTAGLVAGGLAAAVFALSFIVALLYIAQ
Ga0370490_0174418_49_162	3300034128	Untreated Peat Soil	VDRETSRANISAGLLAGGIGAAVFALCFVAAVLYIAS
Ga0364925_0018486_2087_2194	3300034147	Sediment	RETARRDIAAGLVAGGIAAGVFALCFVAAVLYIAS
Ga0334960_000648_11082_11195	3300034402	Sub-Biocrust Soil	VDRETSKRQISAGLVAGGFAAAVFALCFVAATLYIAS
Ga0334905_000287_4010_4123	3300034687	Soil	VDRETSKRQITAGLVAGGFAAAVFALCFVAATLYIAS
Ga0364923_0014158_404_517	3300034690	Sediment	VDRETARRDMAAGLVAGGIAAGVFALCFVAAVLYIAS
Ga0334935_102643_647_757	3300034781	Biocrust	VDRDTARRNIGSGLLYGGIAAAIFALCFIASILYIA
Ga0370497_0055924_631_744	3300034965	Untreated Peat Soil	VDRETARTNMGAGLLAGGIAAAVFALCFVAAMLYIAS