| Basic Information | |
|---|---|
| Family ID | F003627 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 476 |
| Average Sequence Length | 37 residues |
| Representative Sequence | VDRETARKNMGAGLVAGGIAAAVFALCFVAAFLYIAQ |
| Number of Associated Samples | 325 |
| Number of Associated Scaffolds | 476 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 18.53 % |
| % of genes near scaffold ends (potentially truncated) | 12.39 % |
| % of genes from short scaffolds (< 2000 bps) | 64.29 % |
| Associated GOLD sequencing projects | 293 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.076 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.378 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.807 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.017 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 476 Family Scaffolds |
|---|---|---|
| PF01040 | UbiA | 27.94 |
| PF00571 | CBS | 22.90 |
| PF02628 | COX15-CtaA | 5.46 |
| PF00115 | COX1 | 4.62 |
| PF00034 | Cytochrom_C | 4.41 |
| PF00116 | COX2 | 1.68 |
| PF00510 | COX3 | 1.47 |
| PF14378 | PAP2_3 | 1.05 |
| PF02790 | COX2_TM | 0.42 |
| PF13442 | Cytochrome_CBB3 | 0.42 |
| PF02148 | zf-UBP | 0.42 |
| PF13560 | HTH_31 | 0.42 |
| PF01061 | ABC2_membrane | 0.42 |
| PF00378 | ECH_1 | 0.42 |
| PF09656 | PGPGW | 0.42 |
| PF04961 | FTCD_C | 0.21 |
| PF00561 | Abhydrolase_1 | 0.21 |
| PF13460 | NAD_binding_10 | 0.21 |
| PF03706 | LPG_synthase_TM | 0.21 |
| PF07676 | PD40 | 0.21 |
| PF12681 | Glyoxalase_2 | 0.21 |
| PF01176 | eIF-1a | 0.21 |
| PF00484 | Pro_CA | 0.21 |
| PF00768 | Peptidase_S11 | 0.21 |
| PF00246 | Peptidase_M14 | 0.21 |
| PF06570 | DUF1129 | 0.21 |
| PF13531 | SBP_bac_11 | 0.21 |
| PF00368 | HMG-CoA_red | 0.21 |
| PF12697 | Abhydrolase_6 | 0.21 |
| PF07690 | MFS_1 | 0.21 |
| PF02401 | LYTB | 0.21 |
| PF02597 | ThiS | 0.21 |
| PF01476 | LysM | 0.21 |
| PF05297 | Herpes_LMP1 | 0.21 |
| PF14864 | Alkyl_sulf_C | 0.21 |
| PF05977 | MFS_3 | 0.21 |
| PF00958 | GMP_synt_C | 0.21 |
| PF00478 | IMPDH | 0.21 |
| PF11832 | DUF3352 | 0.21 |
| PF06463 | Mob_synth_C | 0.21 |
| PF06314 | ADC | 0.21 |
| PF00293 | NUDIX | 0.21 |
| PF02538 | Hydantoinase_B | 0.21 |
| PF10084 | DUF2322 | 0.21 |
| PF00380 | Ribosomal_S9 | 0.21 |
| PF13692 | Glyco_trans_1_4 | 0.21 |
| PF01035 | DNA_binding_1 | 0.21 |
| PF02397 | Bac_transf | 0.21 |
| PF07992 | Pyr_redox_2 | 0.21 |
| PF03853 | YjeF_N | 0.21 |
| PF05199 | GMC_oxred_C | 0.21 |
| PF02583 | Trns_repr_metal | 0.21 |
| PF01566 | Nramp | 0.21 |
| PF13420 | Acetyltransf_4 | 0.21 |
| PF05988 | DUF899 | 0.21 |
| COG ID | Name | Functional Category | % Frequency in 476 Family Scaffolds |
|---|---|---|---|
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 5.46 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 2.10 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 1.68 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 1.47 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.42 |
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 0.42 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 0.42 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.21 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.21 |
| COG4689 | Acetoacetate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.21 |
| COG3404 | Formiminotetrahydrofolate cyclodeaminase | Amino acid transport and metabolism [E] | 0.21 |
| COG4858 | Uncharacterized membrane-anchored protein | Function unknown [S] | 0.21 |
| COG2896 | GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA) | Coenzyme transport and metabolism [H] | 0.21 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.21 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.21 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.21 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.21 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.21 |
| COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.21 |
| COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 0.21 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG1257 | Hydroxymethylglutaryl-CoA reductase | Lipid transport and metabolism [I] | 0.21 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.21 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.21 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.21 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.21 |
| COG0103 | Ribosomal protein S9 | Translation, ribosomal structure and biogenesis [J] | 0.21 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.08 % |
| Unclassified | root | N/A | 35.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908035|B3_GZOS_CLC_ConsensusfromContig110920 | Not Available | 711 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig12421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1398 | Open in IMG/M |
| 2140918007|ConsensusfromContig172092 | Not Available | 636 | Open in IMG/M |
| 3300000858|JGI10213J12805_10219582 | Not Available | 1123 | Open in IMG/M |
| 3300000953|JGI11615J12901_14471202 | Not Available | 559 | Open in IMG/M |
| 3300000956|JGI10216J12902_100553435 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300000956|JGI10216J12902_100915295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1395 | Open in IMG/M |
| 3300000956|JGI10216J12902_104804225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 1127 | Open in IMG/M |
| 3300000956|JGI10216J12902_113275823 | Not Available | 512 | Open in IMG/M |
| 3300000956|JGI10216J12902_114113440 | Not Available | 747 | Open in IMG/M |
| 3300000956|JGI10216J12902_126470761 | Not Available | 550 | Open in IMG/M |
| 3300001405|JGI20186J14852_1001884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1452 | Open in IMG/M |
| 3300001686|C688J18823_10815282 | Not Available | 593 | Open in IMG/M |
| 3300001977|JGI24746J21847_1000113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9482 | Open in IMG/M |
| 3300001979|JGI24740J21852_10022756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2152 | Open in IMG/M |
| 3300002239|JGI24034J26672_10000115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 12949 | Open in IMG/M |
| 3300003997|Ga0055466_10281911 | Not Available | 505 | Open in IMG/M |
| 3300004001|Ga0055450_10000087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 14428 | Open in IMG/M |
| 3300004114|Ga0062593_102057149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 636 | Open in IMG/M |
| 3300004643|Ga0062591_100413180 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300005329|Ga0070683_100521332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1136 | Open in IMG/M |
| 3300005334|Ga0068869_101497608 | Not Available | 599 | Open in IMG/M |
| 3300005337|Ga0070682_101944814 | Not Available | 516 | Open in IMG/M |
| 3300005344|Ga0070661_100790109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 778 | Open in IMG/M |
| 3300005366|Ga0070659_101539916 | Not Available | 593 | Open in IMG/M |
| 3300005458|Ga0070681_10118723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2581 | Open in IMG/M |
| 3300005526|Ga0073909_10454747 | Not Available | 612 | Open in IMG/M |
| 3300005543|Ga0070672_100000031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 62241 | Open in IMG/M |
| 3300005548|Ga0070665_100002868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 18629 | Open in IMG/M |
| 3300005548|Ga0070665_100038076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 4835 | Open in IMG/M |
| 3300005548|Ga0070665_100467901 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300005548|Ga0070665_101210830 | Not Available | 766 | Open in IMG/M |
| 3300005548|Ga0070665_101683816 | Not Available | 642 | Open in IMG/M |
| 3300005563|Ga0068855_101016967 | Not Available | 870 | Open in IMG/M |
| 3300005563|Ga0068855_102139279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300005564|Ga0070664_100052530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3453 | Open in IMG/M |
| 3300005564|Ga0070664_100918918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 821 | Open in IMG/M |
| 3300005577|Ga0068857_101641337 | Not Available | 628 | Open in IMG/M |
| 3300005578|Ga0068854_100000082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 68340 | Open in IMG/M |
| 3300005578|Ga0068854_100879972 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300005614|Ga0068856_100563038 | Not Available | 1161 | Open in IMG/M |
| 3300005614|Ga0068856_101787964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 626 | Open in IMG/M |
| 3300005614|Ga0068856_102642372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300005616|Ga0068852_100000994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 18720 | Open in IMG/M |
| 3300005616|Ga0068852_101493211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 698 | Open in IMG/M |
| 3300005618|Ga0068864_100000090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 96213 | Open in IMG/M |
| 3300005718|Ga0068866_10000206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 27716 | Open in IMG/M |
| 3300005718|Ga0068866_10016679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 3289 | Open in IMG/M |
| 3300005764|Ga0066903_108227354 | Not Available | 534 | Open in IMG/M |
| 3300005834|Ga0068851_10003112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7354 | Open in IMG/M |
| 3300005841|Ga0068863_100121298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2493 | Open in IMG/M |
| 3300005841|Ga0068863_100533418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1158 | Open in IMG/M |
| 3300005843|Ga0068860_100085478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3002 | Open in IMG/M |
| 3300005843|Ga0068860_101774186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300005873|Ga0075287_1030303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
| 3300005873|Ga0075287_1037430 | Not Available | 644 | Open in IMG/M |
| 3300005983|Ga0081540_1000557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 36162 | Open in IMG/M |
| 3300005983|Ga0081540_1217042 | Not Available | 683 | Open in IMG/M |
| 3300006038|Ga0075365_10749302 | Not Available | 690 | Open in IMG/M |
| 3300006175|Ga0070712_100844868 | Not Available | 787 | Open in IMG/M |
| 3300006237|Ga0097621_100917831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 816 | Open in IMG/M |
| 3300006573|Ga0074055_11833654 | Not Available | 715 | Open in IMG/M |
| 3300006578|Ga0074059_11844374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300006581|Ga0074048_12716516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 678 | Open in IMG/M |
| 3300006606|Ga0074062_13026934 | Not Available | 849 | Open in IMG/M |
| 3300006640|Ga0075527_10003111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3931 | Open in IMG/M |
| 3300006640|Ga0075527_10004485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3372 | Open in IMG/M |
| 3300006642|Ga0075521_10443242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
| 3300006755|Ga0079222_10350031 | Not Available | 997 | Open in IMG/M |
| 3300006755|Ga0079222_10378357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300006755|Ga0079222_10810359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 766 | Open in IMG/M |
| 3300006755|Ga0079222_12077689 | Not Available | 561 | Open in IMG/M |
| 3300006792|Ga0075530_1124152 | Not Available | 831 | Open in IMG/M |
| 3300006804|Ga0079221_11420534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 553 | Open in IMG/M |
| 3300006845|Ga0075421_100052138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5176 | Open in IMG/M |
| 3300006846|Ga0075430_100206320 | Not Available | 1631 | Open in IMG/M |
| 3300006853|Ga0075420_100184089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1827 | Open in IMG/M |
| 3300006854|Ga0075425_100072500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3881 | Open in IMG/M |
| 3300006854|Ga0075425_100247935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2049 | Open in IMG/M |
| 3300006854|Ga0075425_100625637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1238 | Open in IMG/M |
| 3300006876|Ga0079217_11178683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 581 | Open in IMG/M |
| 3300006881|Ga0068865_101561911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 592 | Open in IMG/M |
| 3300006904|Ga0075424_100620086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1155 | Open in IMG/M |
| 3300006953|Ga0074063_12907598 | Not Available | 538 | Open in IMG/M |
| 3300006954|Ga0079219_12122012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 539 | Open in IMG/M |
| 3300007614|Ga0102946_1000094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 29309 | Open in IMG/M |
| 3300007614|Ga0102946_1005686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4133 | Open in IMG/M |
| 3300007757|Ga0102949_1005407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2476 | Open in IMG/M |
| 3300009011|Ga0105251_10598656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300009093|Ga0105240_11294740 | Not Available | 769 | Open in IMG/M |
| 3300009098|Ga0105245_10038238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4270 | Open in IMG/M |
| 3300009101|Ga0105247_10000131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 72578 | Open in IMG/M |
| 3300009112|Ga0115923_10159576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6547 | Open in IMG/M |
| 3300009147|Ga0114129_12316412 | Not Available | 644 | Open in IMG/M |
| 3300009156|Ga0111538_10654955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1331 | Open in IMG/M |
| 3300009156|Ga0111538_13978721 | Not Available | 511 | Open in IMG/M |
| 3300009162|Ga0075423_10372678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1498 | Open in IMG/M |
| 3300009174|Ga0105241_10116429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2146 | Open in IMG/M |
| 3300009176|Ga0105242_10000428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 33565 | Open in IMG/M |
| 3300009176|Ga0105242_10632194 | Not Available | 1038 | Open in IMG/M |
| 3300009176|Ga0105242_11293836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300009545|Ga0105237_10257220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1748 | Open in IMG/M |
| 3300009551|Ga0105238_10000033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 172981 | Open in IMG/M |
| 3300009551|Ga0105238_10476263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1247 | Open in IMG/M |
| 3300009553|Ga0105249_10000218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 65480 | Open in IMG/M |
| 3300009553|Ga0105249_10738102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
| 3300009553|Ga0105249_11034453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
| 3300009553|Ga0105249_11398991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300009610|Ga0105340_1321008 | Not Available | 679 | Open in IMG/M |
| 3300009789|Ga0126307_10037119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 3773 | Open in IMG/M |
| 3300009789|Ga0126307_10995031 | Not Available | 678 | Open in IMG/M |
| 3300009789|Ga0126307_11708330 | Not Available | 512 | Open in IMG/M |
| 3300009840|Ga0126313_10272624 | Not Available | 1317 | Open in IMG/M |
| 3300009840|Ga0126313_10280002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1300 | Open in IMG/M |
| 3300009870|Ga0131092_10178996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2263 | Open in IMG/M |
| 3300009870|Ga0131092_10401499 | Not Available | 1276 | Open in IMG/M |
| 3300010036|Ga0126305_10104745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1705 | Open in IMG/M |
| 3300010037|Ga0126304_10167226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1429 | Open in IMG/M |
| 3300010037|Ga0126304_10826320 | Not Available | 629 | Open in IMG/M |
| 3300010039|Ga0126309_10000017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 54762 | Open in IMG/M |
| 3300010042|Ga0126314_11089025 | Not Available | 595 | Open in IMG/M |
| 3300010043|Ga0126380_10882144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
| 3300010044|Ga0126310_11117476 | Not Available | 628 | Open in IMG/M |
| 3300010045|Ga0126311_10003129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8479 | Open in IMG/M |
| 3300010045|Ga0126311_10139089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1717 | Open in IMG/M |
| 3300010045|Ga0126311_10258163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1296 | Open in IMG/M |
| 3300010045|Ga0126311_11323361 | Not Available | 599 | Open in IMG/M |
| 3300010047|Ga0126382_11054215 | Not Available | 717 | Open in IMG/M |
| 3300010051|Ga0133939_1071945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1626 | Open in IMG/M |
| 3300010166|Ga0126306_10189877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1547 | Open in IMG/M |
| 3300010166|Ga0126306_10395799 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300010323|Ga0134086_10332047 | Not Available | 597 | Open in IMG/M |
| 3300010359|Ga0126376_11924254 | Not Available | 632 | Open in IMG/M |
| 3300010360|Ga0126372_12488306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300010362|Ga0126377_10310066 | Not Available | 1559 | Open in IMG/M |
| 3300010371|Ga0134125_13049001 | Not Available | 508 | Open in IMG/M |
| 3300010373|Ga0134128_11476005 | Not Available | 749 | Open in IMG/M |
| 3300010373|Ga0134128_12068987 | Not Available | 627 | Open in IMG/M |
| 3300010375|Ga0105239_10487371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1401 | Open in IMG/M |
| 3300010396|Ga0134126_10033254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6521 | Open in IMG/M |
| 3300010400|Ga0134122_12927715 | Not Available | 531 | Open in IMG/M |
| 3300010403|Ga0134123_10083601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2495 | Open in IMG/M |
| 3300010403|Ga0134123_10161789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1865 | Open in IMG/M |
| 3300011119|Ga0105246_11024624 | Not Available | 749 | Open in IMG/M |
| 3300011418|Ga0153954_1142521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300012014|Ga0120159_1077078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea | 986 | Open in IMG/M |
| 3300012039|Ga0137421_1156282 | Not Available | 672 | Open in IMG/M |
| 3300012090|Ga0153956_1001713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 18287 | Open in IMG/M |
| 3300012201|Ga0137365_10425872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 978 | Open in IMG/M |
| 3300012212|Ga0150985_100417282 | Not Available | 840 | Open in IMG/M |
| 3300012212|Ga0150985_103669512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
| 3300012212|Ga0150985_114396883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
| 3300012212|Ga0150985_116019057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea | 1163 | Open in IMG/M |
| 3300012212|Ga0150985_120976048 | Not Available | 681 | Open in IMG/M |
| 3300012356|Ga0137371_10012271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 6622 | Open in IMG/M |
| 3300012469|Ga0150984_104121735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300012469|Ga0150984_105559461 | Not Available | 895 | Open in IMG/M |
| 3300012469|Ga0150984_115982619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300012895|Ga0157309_10305733 | Not Available | 538 | Open in IMG/M |
| 3300012900|Ga0157292_10000006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 118494 | Open in IMG/M |
| 3300012900|Ga0157292_10068576 | Not Available | 994 | Open in IMG/M |
| 3300012907|Ga0157283_10000825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4369 | Open in IMG/M |
| 3300012908|Ga0157286_10310134 | Not Available | 581 | Open in IMG/M |
| 3300012909|Ga0157290_10000661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 4566 | Open in IMG/M |
| 3300012913|Ga0157298_10000004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 155123 | Open in IMG/M |
| 3300012914|Ga0157297_10241968 | Not Available | 648 | Open in IMG/M |
| 3300012915|Ga0157302_10225747 | Not Available | 687 | Open in IMG/M |
| 3300012924|Ga0137413_10259288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
| 3300012924|Ga0137413_11804039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300012929|Ga0137404_10863096 | Not Available | 824 | Open in IMG/M |
| 3300012939|Ga0162650_100000300 | All Organisms → cellular organisms → Bacteria | 4040 | Open in IMG/M |
| 3300012942|Ga0164242_10362293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1074 | Open in IMG/M |
| 3300012942|Ga0164242_10612386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300012943|Ga0164241_10001524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 28185 | Open in IMG/M |
| 3300012943|Ga0164241_10017016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5825 | Open in IMG/M |
| 3300012943|Ga0164241_10036645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 3675 | Open in IMG/M |
| 3300012944|Ga0137410_11251274 | Not Available | 640 | Open in IMG/M |
| 3300012948|Ga0126375_12047334 | Not Available | 507 | Open in IMG/M |
| 3300012951|Ga0164300_10341729 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300012955|Ga0164298_10163283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1265 | Open in IMG/M |
| 3300012955|Ga0164298_10723404 | Not Available | 701 | Open in IMG/M |
| 3300012955|Ga0164298_11420056 | Not Available | 538 | Open in IMG/M |
| 3300012955|Ga0164298_11638586 | Not Available | 508 | Open in IMG/M |
| 3300012957|Ga0164303_11096338 | Not Available | 574 | Open in IMG/M |
| 3300012958|Ga0164299_10022671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2604 | Open in IMG/M |
| 3300012958|Ga0164299_10706124 | Not Available | 706 | Open in IMG/M |
| 3300012958|Ga0164299_11237354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 567 | Open in IMG/M |
| 3300012985|Ga0164308_10605455 | Not Available | 933 | Open in IMG/M |
| 3300012985|Ga0164308_11660472 | Not Available | 592 | Open in IMG/M |
| 3300012986|Ga0164304_11099355 | Not Available | 636 | Open in IMG/M |
| 3300012987|Ga0164307_10034647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2768 | Open in IMG/M |
| 3300012987|Ga0164307_10607999 | Not Available | 844 | Open in IMG/M |
| 3300012987|Ga0164307_10968412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 690 | Open in IMG/M |
| 3300012989|Ga0164305_11221080 | Not Available | 653 | Open in IMG/M |
| 3300013104|Ga0157370_10126005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2390 | Open in IMG/M |
| 3300013297|Ga0157378_10016178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6532 | Open in IMG/M |
| 3300013297|Ga0157378_10149338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2176 | Open in IMG/M |
| 3300013297|Ga0157378_11046379 | Not Available | 852 | Open in IMG/M |
| 3300013306|Ga0163162_11217687 | Not Available | 855 | Open in IMG/M |
| 3300013308|Ga0157375_10009414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8576 | Open in IMG/M |
| 3300013308|Ga0157375_12514616 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300013308|Ga0157375_12954415 | Not Available | 568 | Open in IMG/M |
| 3300013772|Ga0120158_10310750 | Not Available | 758 | Open in IMG/M |
| 3300014254|Ga0075312_1128446 | Not Available | 547 | Open in IMG/M |
| 3300014254|Ga0075312_1134643 | Not Available | 538 | Open in IMG/M |
| 3300014255|Ga0075320_1034971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 864 | Open in IMG/M |
| 3300014259|Ga0075311_1023598 | Not Available | 1111 | Open in IMG/M |
| 3300014263|Ga0075324_1000003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 192656 | Open in IMG/M |
| 3300014267|Ga0075313_1207304 | Not Available | 522 | Open in IMG/M |
| 3300014270|Ga0075325_1000062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 13504 | Open in IMG/M |
| 3300014270|Ga0075325_1015108 | Not Available | 1396 | Open in IMG/M |
| 3300014270|Ga0075325_1104796 | Not Available | 671 | Open in IMG/M |
| 3300014271|Ga0075326_1259371 | Not Available | 536 | Open in IMG/M |
| 3300014299|Ga0075303_1003019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1846 | Open in IMG/M |
| 3300014300|Ga0075321_1069177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300014301|Ga0075323_1121038 | Not Available | 579 | Open in IMG/M |
| 3300014311|Ga0075322_1000344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 6104 | Open in IMG/M |
| 3300014314|Ga0075316_1021065 | Not Available | 1274 | Open in IMG/M |
| 3300014325|Ga0163163_10278387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1724 | Open in IMG/M |
| 3300014325|Ga0163163_10289046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1691 | Open in IMG/M |
| 3300014325|Ga0163163_11593631 | Not Available | 714 | Open in IMG/M |
| 3300014326|Ga0157380_10001343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 16023 | Open in IMG/M |
| 3300014487|Ga0182000_10008400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2435 | Open in IMG/M |
| 3300014498|Ga0182019_10103938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1742 | Open in IMG/M |
| 3300014745|Ga0157377_10206552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1250 | Open in IMG/M |
| 3300014968|Ga0157379_10088527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2777 | Open in IMG/M |
| 3300014968|Ga0157379_10712100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300014969|Ga0157376_10078125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2833 | Open in IMG/M |
| 3300015069|Ga0167633_114515 | Not Available | 918 | Open in IMG/M |
| 3300015085|Ga0167632_1021861 | Not Available | 873 | Open in IMG/M |
| 3300015089|Ga0167643_1031121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
| 3300015090|Ga0167634_1003610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2059 | Open in IMG/M |
| 3300015200|Ga0173480_10931117 | Not Available | 567 | Open in IMG/M |
| 3300015242|Ga0137412_10962701 | Not Available | 614 | Open in IMG/M |
| 3300015242|Ga0137412_11038831 | Not Available | 584 | Open in IMG/M |
| 3300015371|Ga0132258_11061157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2048 | Open in IMG/M |
| 3300017792|Ga0163161_10008446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7130 | Open in IMG/M |
| 3300017930|Ga0187825_10125359 | Not Available | 898 | Open in IMG/M |
| 3300017965|Ga0190266_10074556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1303 | Open in IMG/M |
| 3300018067|Ga0184611_1217818 | Not Available | 679 | Open in IMG/M |
| 3300018071|Ga0184618_10159215 | Not Available | 927 | Open in IMG/M |
| 3300018422|Ga0190265_10000063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 122964 | Open in IMG/M |
| 3300018422|Ga0190265_10054813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3503 | Open in IMG/M |
| 3300018422|Ga0190265_10087103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2880 | Open in IMG/M |
| 3300018422|Ga0190265_10148450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2289 | Open in IMG/M |
| 3300018429|Ga0190272_10011078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 4432 | Open in IMG/M |
| 3300018429|Ga0190272_10147731 | Not Available | 1612 | Open in IMG/M |
| 3300018429|Ga0190272_10252473 | Not Available | 1325 | Open in IMG/M |
| 3300018429|Ga0190272_10387094 | Not Available | 1134 | Open in IMG/M |
| 3300018431|Ga0066655_10163967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1335 | Open in IMG/M |
| 3300018432|Ga0190275_10000304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 47598 | Open in IMG/M |
| 3300018432|Ga0190275_10003499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11225 | Open in IMG/M |
| 3300018432|Ga0190275_11300242 | Not Available | 803 | Open in IMG/M |
| 3300018432|Ga0190275_11758871 | Not Available | 698 | Open in IMG/M |
| 3300018432|Ga0190275_12009533 | Not Available | 657 | Open in IMG/M |
| 3300018465|Ga0190269_10001067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 13332 | Open in IMG/M |
| 3300018466|Ga0190268_10225737 | Not Available | 1050 | Open in IMG/M |
| 3300018469|Ga0190270_10026236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3709 | Open in IMG/M |
| 3300018469|Ga0190270_10071919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2521 | Open in IMG/M |
| 3300018469|Ga0190270_10560405 | Not Available | 1104 | Open in IMG/M |
| 3300018469|Ga0190270_10938055 | Not Available | 887 | Open in IMG/M |
| 3300018469|Ga0190270_12033886 | Not Available | 633 | Open in IMG/M |
| 3300018476|Ga0190274_10000037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 126925 | Open in IMG/M |
| 3300018476|Ga0190274_10000647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 20387 | Open in IMG/M |
| 3300018476|Ga0190274_10065204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2719 | Open in IMG/M |
| 3300018476|Ga0190274_10279527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1537 | Open in IMG/M |
| 3300018481|Ga0190271_10000013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 178071 | Open in IMG/M |
| 3300018481|Ga0190271_10000157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 34663 | Open in IMG/M |
| 3300018481|Ga0190271_10023657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4803 | Open in IMG/M |
| 3300018481|Ga0190271_10037326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4000 | Open in IMG/M |
| 3300018481|Ga0190271_10912305 | Not Available | 1003 | Open in IMG/M |
| 3300018920|Ga0190273_10000018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 124864 | Open in IMG/M |
| 3300018920|Ga0190273_10212013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1222 | Open in IMG/M |
| 3300018920|Ga0190273_10497074 | Not Available | 891 | Open in IMG/M |
| 3300018920|Ga0190273_11385435 | Not Available | 613 | Open in IMG/M |
| 3300019377|Ga0190264_10250996 | Not Available | 1026 | Open in IMG/M |
| 3300019377|Ga0190264_10614910 | Not Available | 779 | Open in IMG/M |
| 3300019875|Ga0193701_1100403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300019881|Ga0193707_1088164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 942 | Open in IMG/M |
| 3300019884|Ga0193741_1016487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1903 | Open in IMG/M |
| 3300019889|Ga0193743_1001890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 15113 | Open in IMG/M |
| 3300020005|Ga0193697_1069486 | Not Available | 865 | Open in IMG/M |
| 3300020020|Ga0193738_1034477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1562 | Open in IMG/M |
| 3300020021|Ga0193726_1047600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2057 | Open in IMG/M |
| 3300020021|Ga0193726_1050477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1985 | Open in IMG/M |
| 3300020022|Ga0193733_1102360 | Not Available | 799 | Open in IMG/M |
| 3300020034|Ga0193753_10076177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1723 | Open in IMG/M |
| 3300020034|Ga0193753_10116183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1314 | Open in IMG/M |
| 3300020059|Ga0193745_1024786 | Not Available | 1315 | Open in IMG/M |
| 3300020069|Ga0197907_10870875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
| 3300020070|Ga0206356_10666627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2422 | Open in IMG/M |
| 3300020077|Ga0206351_10408391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1040 | Open in IMG/M |
| 3300020154|Ga0196965_1166214 | Not Available | 571 | Open in IMG/M |
| 3300020181|Ga0196958_10002198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5976 | Open in IMG/M |
| 3300020181|Ga0196958_10143598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 820 | Open in IMG/M |
| 3300020181|Ga0196958_10212246 | Not Available | 692 | Open in IMG/M |
| 3300020610|Ga0154015_1540969 | Not Available | 806 | Open in IMG/M |
| 3300021086|Ga0179596_10638289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300021339|Ga0193706_1007093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 4093 | Open in IMG/M |
| 3300021339|Ga0193706_1012390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2868 | Open in IMG/M |
| 3300021339|Ga0193706_1053022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1136 | Open in IMG/M |
| 3300021363|Ga0193699_10119504 | Not Available | 1073 | Open in IMG/M |
| 3300021401|Ga0210393_10295700 | Not Available | 1315 | Open in IMG/M |
| 3300021403|Ga0210397_10085566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2099 | Open in IMG/M |
| 3300021412|Ga0193736_1057987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300021445|Ga0182009_10641761 | Not Available | 571 | Open in IMG/M |
| 3300021559|Ga0210409_10010053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 9545 | Open in IMG/M |
| 3300021560|Ga0126371_10936224 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300022756|Ga0222622_10049022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2374 | Open in IMG/M |
| 3300022756|Ga0222622_10603769 | Not Available | 792 | Open in IMG/M |
| 3300022880|Ga0247792_1011158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1384 | Open in IMG/M |
| 3300022899|Ga0247795_1000128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11829 | Open in IMG/M |
| 3300022910|Ga0247768_1000016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 168636 | Open in IMG/M |
| 3300023067|Ga0247743_1002044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2237 | Open in IMG/M |
| 3300023102|Ga0247754_1000752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5124 | Open in IMG/M |
| 3300023265|Ga0247780_1001443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 13674 | Open in IMG/M |
| 3300023266|Ga0247789_1010551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1448 | Open in IMG/M |
| 3300023266|Ga0247789_1056555 | Not Available | 730 | Open in IMG/M |
| 3300023268|Ga0247765_1005325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3623 | Open in IMG/M |
| 3300023275|Ga0247776_10000281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11878 | Open in IMG/M |
| 3300024055|Ga0247794_10063550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1037 | Open in IMG/M |
| 3300024347|Ga0179591_1180883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2787 | Open in IMG/M |
| 3300024426|Ga0196960_10000579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 12006 | Open in IMG/M |
| 3300024426|Ga0196960_10063785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1050 | Open in IMG/M |
| 3300024430|Ga0196962_10000259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 25574 | Open in IMG/M |
| 3300024996|Ga0209916_1000951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 33149 | Open in IMG/M |
| 3300025321|Ga0207656_10017412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2815 | Open in IMG/M |
| 3300025504|Ga0208356_1000005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 131014 | Open in IMG/M |
| 3300025535|Ga0207423_1009837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1471 | Open in IMG/M |
| 3300025538|Ga0210132_1000139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 9952 | Open in IMG/M |
| 3300025552|Ga0210142_1006585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2107 | Open in IMG/M |
| 3300025565|Ga0210110_1002650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5140 | Open in IMG/M |
| 3300025565|Ga0210110_1010855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2429 | Open in IMG/M |
| 3300025568|Ga0210095_1017120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1654 | Open in IMG/M |
| 3300025571|Ga0207874_1060801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 876 | Open in IMG/M |
| 3300025583|Ga0210085_1000593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 15027 | Open in IMG/M |
| 3300025593|Ga0210096_1198200 | Not Available | 558 | Open in IMG/M |
| 3300025615|Ga0210086_1013182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2985 | Open in IMG/M |
| 3300025615|Ga0210086_1101045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea | 856 | Open in IMG/M |
| 3300025625|Ga0208219_1003138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5777 | Open in IMG/M |
| 3300025634|Ga0208589_1100834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300025780|Ga0210100_1000230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9368 | Open in IMG/M |
| 3300025780|Ga0210100_1000251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8607 | Open in IMG/M |
| 3300025798|Ga0210063_1000059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 35806 | Open in IMG/M |
| 3300025799|Ga0210122_1009057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 2730 | Open in IMG/M |
| 3300025814|Ga0210101_1000196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 22236 | Open in IMG/M |
| 3300025814|Ga0210101_1000339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 16253 | Open in IMG/M |
| 3300025814|Ga0210101_1104764 | Not Available | 741 | Open in IMG/M |
| 3300025817|Ga0210144_1000148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 40255 | Open in IMG/M |
| 3300025817|Ga0210144_1000280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 29393 | Open in IMG/M |
| 3300025817|Ga0210144_1129479 | Not Available | 726 | Open in IMG/M |
| 3300025823|Ga0210123_1049813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1371 | Open in IMG/M |
| 3300025823|Ga0210123_1122426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300025854|Ga0209176_10016780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1478 | Open in IMG/M |
| 3300025878|Ga0209584_10277228 | Not Available | 643 | Open in IMG/M |
| 3300025898|Ga0207692_10126787 | Not Available | 1437 | Open in IMG/M |
| 3300025899|Ga0207642_10000005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 401934 | Open in IMG/M |
| 3300025899|Ga0207642_10000737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 10119 | Open in IMG/M |
| 3300025899|Ga0207642_10019348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2635 | Open in IMG/M |
| 3300025905|Ga0207685_10000012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 189900 | Open in IMG/M |
| 3300025906|Ga0207699_11133220 | Not Available | 579 | Open in IMG/M |
| 3300025908|Ga0207643_10663734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 673 | Open in IMG/M |
| 3300025911|Ga0207654_10650429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
| 3300025912|Ga0207707_10059817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3315 | Open in IMG/M |
| 3300025912|Ga0207707_11095448 | Not Available | 649 | Open in IMG/M |
| 3300025915|Ga0207693_10010825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7404 | Open in IMG/M |
| 3300025915|Ga0207693_11212994 | Not Available | 568 | Open in IMG/M |
| 3300025919|Ga0207657_10166653 | Not Available | 1787 | Open in IMG/M |
| 3300025924|Ga0207694_10000012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 411218 | Open in IMG/M |
| 3300025924|Ga0207694_10496541 | Not Available | 1022 | Open in IMG/M |
| 3300025926|Ga0207659_10000055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 74252 | Open in IMG/M |
| 3300025927|Ga0207687_10020955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4339 | Open in IMG/M |
| 3300025928|Ga0207700_10000003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 500797 | Open in IMG/M |
| 3300025929|Ga0207664_10015535 | All Organisms → cellular organisms → Bacteria | 5529 | Open in IMG/M |
| 3300025934|Ga0207686_10339430 | Not Available | 1128 | Open in IMG/M |
| 3300025937|Ga0207669_10107293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1862 | Open in IMG/M |
| 3300025938|Ga0207704_10245347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1341 | Open in IMG/M |
| 3300025938|Ga0207704_11253647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 633 | Open in IMG/M |
| 3300025939|Ga0207665_11437424 | Not Available | 549 | Open in IMG/M |
| 3300025946|Ga0210126_100464 | All Organisms → cellular organisms → Bacteria | 3202 | Open in IMG/M |
| 3300025949|Ga0207667_10617093 | Not Available | 1092 | Open in IMG/M |
| 3300025949|Ga0207667_10700316 | Not Available | 1015 | Open in IMG/M |
| 3300025961|Ga0207712_10000027 | All Organisms → cellular organisms → Bacteria | 263739 | Open in IMG/M |
| 3300025961|Ga0207712_11045290 | Not Available | 726 | Open in IMG/M |
| 3300025961|Ga0207712_11213984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300025986|Ga0207658_10103947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2231 | Open in IMG/M |
| 3300025986|Ga0207658_10486284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1097 | Open in IMG/M |
| 3300025986|Ga0207658_10532709 | Not Available | 1049 | Open in IMG/M |
| 3300025996|Ga0208777_1010761 | Not Available | 775 | Open in IMG/M |
| 3300025996|Ga0208777_1013266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 699 | Open in IMG/M |
| 3300026023|Ga0207677_10003648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8170 | Open in IMG/M |
| 3300026023|Ga0207677_10009001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5602 | Open in IMG/M |
| 3300026051|Ga0208911_1000261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4107 | Open in IMG/M |
| 3300026051|Ga0208911_1004916 | Not Available | 1204 | Open in IMG/M |
| 3300026058|Ga0208421_1018676 | Not Available | 626 | Open in IMG/M |
| 3300026066|Ga0208290_1000039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5761 | Open in IMG/M |
| 3300026067|Ga0207678_10118785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2256 | Open in IMG/M |
| 3300026067|Ga0207678_10347112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1280 | Open in IMG/M |
| 3300026075|Ga0207708_10524947 | Not Available | 995 | Open in IMG/M |
| 3300026088|Ga0207641_10076027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2902 | Open in IMG/M |
| 3300026095|Ga0207676_10000016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 311561 | Open in IMG/M |
| 3300026107|Ga0209950_1005058 | Not Available | 1410 | Open in IMG/M |
| 3300026121|Ga0207683_10196742 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300026142|Ga0207698_11593350 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300026142|Ga0207698_11721077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 642 | Open in IMG/M |
| 3300026142|Ga0207698_12265682 | Not Available | 555 | Open in IMG/M |
| 3300027524|Ga0208998_1000008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 116202 | Open in IMG/M |
| 3300027636|Ga0214469_1002897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 6389 | Open in IMG/M |
| 3300027636|Ga0214469_1145766 | Not Available | 670 | Open in IMG/M |
| 3300027725|Ga0209178_1358226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300027787|Ga0209074_10447444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300027909|Ga0209382_10023534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 7459 | Open in IMG/M |
| 3300028293|Ga0247662_1064979 | Not Available | 644 | Open in IMG/M |
| 3300028379|Ga0268266_10015588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6515 | Open in IMG/M |
| 3300028379|Ga0268266_11199042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 734 | Open in IMG/M |
| 3300028380|Ga0268265_12430781 | Not Available | 530 | Open in IMG/M |
| 3300028381|Ga0268264_10001191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 25160 | Open in IMG/M |
| 3300028381|Ga0268264_12137917 | Not Available | 568 | Open in IMG/M |
| 3300028556|Ga0265337_1001256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 12773 | Open in IMG/M |
| 3300028556|Ga0265337_1199593 | Not Available | 543 | Open in IMG/M |
| 3300028558|Ga0265326_10156483 | Not Available | 651 | Open in IMG/M |
| 3300028712|Ga0307285_10000004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 246966 | Open in IMG/M |
| 3300028714|Ga0307309_10056196 | Not Available | 867 | Open in IMG/M |
| 3300028721|Ga0307315_10057660 | Not Available | 1091 | Open in IMG/M |
| 3300028768|Ga0307280_10000024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 47053 | Open in IMG/M |
| 3300028768|Ga0307280_10252238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 635 | Open in IMG/M |
| 3300028768|Ga0307280_10260103 | Not Available | 626 | Open in IMG/M |
| 3300028782|Ga0307306_10000044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 25664 | Open in IMG/M |
| 3300028802|Ga0307503_10000132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 35030 | Open in IMG/M |
| 3300028802|Ga0307503_10629734 | Not Available | 595 | Open in IMG/M |
| 3300028875|Ga0307289_10035626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1970 | Open in IMG/M |
| 3300029987|Ga0311334_11820946 | Not Available | 519 | Open in IMG/M |
| 3300030006|Ga0299907_10203087 | Not Available | 1635 | Open in IMG/M |
| 3300030499|Ga0268259_10092395 | Not Available | 668 | Open in IMG/M |
| 3300030510|Ga0268243_1006865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2026 | Open in IMG/M |
| 3300031184|Ga0307499_10005236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2673 | Open in IMG/M |
| 3300031226|Ga0307497_10489173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 605 | Open in IMG/M |
| 3300031228|Ga0299914_10000191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 36365 | Open in IMG/M |
| 3300031228|Ga0299914_10010643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7051 | Open in IMG/M |
| 3300031229|Ga0299913_10093294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2933 | Open in IMG/M |
| 3300031274|Ga0307442_1132132 | Not Available | 709 | Open in IMG/M |
| 3300031367|Ga0307440_1007722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4139 | Open in IMG/M |
| 3300031367|Ga0307440_1143474 | Not Available | 664 | Open in IMG/M |
| 3300031411|Ga0102761_12173612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300031740|Ga0307468_101028947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300031873|Ga0315297_10354097 | Not Available | 1229 | Open in IMG/M |
| 3300031938|Ga0308175_100000371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 31471 | Open in IMG/M |
| 3300031996|Ga0308176_10487991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1248 | Open in IMG/M |
| 3300032002|Ga0307416_103064029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 559 | Open in IMG/M |
| 3300032074|Ga0308173_11852421 | Not Available | 569 | Open in IMG/M |
| 3300032080|Ga0326721_10000051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 96017 | Open in IMG/M |
| 3300032126|Ga0307415_100649460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 945 | Open in IMG/M |
| 3300032157|Ga0315912_11201659 | Not Available | 601 | Open in IMG/M |
| 3300032174|Ga0307470_10008781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4095 | Open in IMG/M |
| 3300032174|Ga0307470_11080195 | Not Available | 644 | Open in IMG/M |
| 3300032180|Ga0307471_100178776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2090 | Open in IMG/M |
| 3300032205|Ga0307472_101189987 | Not Available | 727 | Open in IMG/M |
| 3300032205|Ga0307472_101428365 | Not Available | 672 | Open in IMG/M |
| 3300032829|Ga0335070_10000099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 97495 | Open in IMG/M |
| 3300032829|Ga0335070_10109147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2881 | Open in IMG/M |
| 3300032829|Ga0335070_10190739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2048 | Open in IMG/M |
| 3300032829|Ga0335070_10238497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1789 | Open in IMG/M |
| 3300032896|Ga0335075_10466718 | Not Available | 1307 | Open in IMG/M |
| 3300032896|Ga0335075_11293618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300032954|Ga0335083_10000084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 167442 | Open in IMG/M |
| 3300032954|Ga0335083_11336632 | Not Available | 550 | Open in IMG/M |
| 3300033433|Ga0326726_10028034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 4900 | Open in IMG/M |
| 3300034125|Ga0370484_0042838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1107 | Open in IMG/M |
| 3300034128|Ga0370490_0174418 | Not Available | 705 | Open in IMG/M |
| 3300034147|Ga0364925_0018486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2196 | Open in IMG/M |
| 3300034402|Ga0334960_000648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 12916 | Open in IMG/M |
| 3300034687|Ga0334905_000287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7295 | Open in IMG/M |
| 3300034690|Ga0364923_0014158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1759 | Open in IMG/M |
| 3300034781|Ga0334935_102643 | Not Available | 781 | Open in IMG/M |
| 3300034965|Ga0370497_0055924 | Not Available | 881 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.38% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.25% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.10% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.10% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.10% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.47% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.47% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.05% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.05% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.05% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.84% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.63% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.63% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.42% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.42% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.42% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.42% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.42% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.21% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.21% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.21% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.21% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.21% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.21% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.21% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.21% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.21% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.21% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.21% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.21% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.21% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.21% |
| Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.21% |
| Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 0.21% |
| Swimming Pool Sandfilter Backwash | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash | 0.21% |
| Wastewater Bioreactor | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor | 0.21% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908035 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001405 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
| 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Host-Associated | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300004001 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006792 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007614 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG | Environmental | Open in IMG/M |
| 3300007757 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D1_MG | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009112 | Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2 | Engineered | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011418 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG | Host-Associated | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012090 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL040 MetaG | Host-Associated | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012942 | Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015069 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake | Environmental | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015090 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020154 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_20 | Environmental | Open in IMG/M |
| 3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
| 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300022910 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6 | Environmental | Open in IMG/M |
| 3300023067 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300023265 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300023268 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6 | Environmental | Open in IMG/M |
| 3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024426 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5 | Environmental | Open in IMG/M |
| 3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
| 3300024996 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_2 (SPAdes) | Engineered | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025565 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025568 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025571 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-1-D (SPAdes) | Engineered | Open in IMG/M |
| 3300025583 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025593 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025615 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025780 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025798 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025799 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025814 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025817 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025823 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025946 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025996 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026051 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026058 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026066 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026107 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027524 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031274 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30 | Environmental | Open in IMG/M |
| 3300031367 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-10 | Environmental | Open in IMG/M |
| 3300031411 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034402 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 56SNS | Environmental | Open in IMG/M |
| 3300034687 | Soil microbial communities from Mojave Desert, California, United States - 1NOC | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| 3300034781 | Biocrust microbial communities from Mojave Desert, California, United States - 31SMC | Environmental | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B3_GZOS_CLC_02219370 | 2124908035 | Soil | VDRETARKNMTSGLIAGGFAAAIFALSFVVAFLYIAQ |
| A5_c1_00677410 | 2124908044 | Soil | VDRETARKNMSAGLFAGAVAATIFALSFVAAFLYIAQ |
| A_all_C_03187310 | 2140918007 | Soil | VDRETARRNMIGGLMAGGFAAAIFALSFVVALLYIAQ |
| JGI10213J12805_102195822 | 3300000858 | Soil | MDRETSRANVSAGLVAGGIAAAVFALCFVAAVLYIAS* |
| JGI11615J12901_144712022 | 3300000953 | Soil | VDRETARSSISAGLLAGGIAAAVFALSFVAAVLYIAS* |
| JGI10216J12902_1005534354 | 3300000956 | Soil | MDRESSRQSIRAGLVAGGFAAGVFALCFVAAFLYIAQ* |
| JGI10216J12902_1009152954 | 3300000956 | Soil | VDRETYRRDLRAGLVAGGVAAAIFAICFVVATLYIAS* |
| JGI10216J12902_1048042253 | 3300000956 | Soil | MDRENARRQLSAGLVTGGIAAGVFALCFVAAFLYIAQ* |
| JGI10216J12902_1132758232 | 3300000956 | Soil | MDRESARRSLSAGLVTGGIAAGIFALSFVAAFLYIAQ* |
| JGI10216J12902_1141134402 | 3300000956 | Soil | MDRETARRSMSAGLVAGGIAVGVFALCFVTAFIYIAQ* |
| JGI10216J12902_1264707612 | 3300000956 | Soil | MDRENARRQISAGLVTGGIAAGVFALSFIAAFLYIAQ* |
| JGI20186J14852_10018842 | 3300001405 | Arctic Peat Soil | MDRETARKNMVGGLVAGGFAAAIFALAFVVAFLYIAQ* |
| C688J18823_108152822 | 3300001686 | Soil | VDRETARGNMSAGLVAGGIAAAIFALCFVAAMLYIAS* |
| JGI24746J21847_100011315 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | PAVDRETSKRQISAGLVAGGFAAAIFALCFVAATLYIAS* |
| JGI24740J21852_100227565 | 3300001979 | Corn Rhizosphere | VDRETARKNMAAGLVAAGFATAIFALTFVAALLYIAQG* |
| JGI24034J26672_100001152 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRETARRDIGAGLLAAGIAASVFALCFVAAMLYIAS* |
| Ga0055466_102819112 | 3300003997 | Natural And Restored Wetlands | DRTPAVDRETSRRDMAAGLLAGGIAAAIFALCFLAATLYIAS* |
| Ga0055450_100000878 | 3300004001 | Natural And Restored Wetlands | LIEIQAMDRELARKNMSTGLVAGGLAVAVFALAFLAAFLYIAVS* |
| Ga0062593_1020571493 | 3300004114 | Soil | PRSLVKIQLVDRRTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS* |
| Ga0062591_1004131801 | 3300004643 | Soil | PPVDRERARSNIAAGLLAGGIAAAVFALAFVAAVLYIAS* |
| Ga0070683_1005213321 | 3300005329 | Corn Rhizosphere | SLVKIQLVDRRTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS* |
| Ga0068869_1014976082 | 3300005334 | Miscanthus Rhizosphere | VLMDREQARKNMVGGLVAGGFATAIFALAFVAAFLYIAQS* |
| Ga0070682_1019448141 | 3300005337 | Corn Rhizosphere | DRNPAVDRETARKNMSAGLVAGGLAATVFALCFVAAFLYIAQ* |
| Ga0070661_1007901091 | 3300005344 | Corn Rhizosphere | RSSGRNPPVDRERARSNIAAGLLAGGIAAAVFALAFVAAVLYIAS* |
| Ga0070659_1015399162 | 3300005366 | Corn Rhizosphere | RNPPVDRESARSSISAGLLAGGVAAAVFALSFVVAVLYVAS* |
| Ga0070681_101187235 | 3300005458 | Corn Rhizosphere | GHPPALEAARTDRNPAVDRETARRSMTAGMVAGGFAAVVFALCFIVALLYIAHG* |
| Ga0073909_104547472 | 3300005526 | Surface Soil | MDRETARRDMTAGLLAGGIAAAVFALCFVAAMLYIASA* |
| Ga0070672_10000003158 | 3300005543 | Miscanthus Rhizosphere | MDRETARRQLKAGLVAGGIAAGVFALSFVAAFLYIAQ* |
| Ga0070665_10000286811 | 3300005548 | Switchgrass Rhizosphere | MDRETARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0070665_1000380763 | 3300005548 | Switchgrass Rhizosphere | MDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYVAA* |
| Ga0070665_1004679012 | 3300005548 | Switchgrass Rhizosphere | VDRETARKNMSAGLVAGGFAAAVFALAFVAAFLYVGAA* |
| Ga0070665_1012108301 | 3300005548 | Switchgrass Rhizosphere | MDRETARRQMRAGLVTGGIAAGVFALSFVAAFLYIAGS* |
| Ga0070665_1016838162 | 3300005548 | Switchgrass Rhizosphere | VDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH* |
| Ga0068855_1010169672 | 3300005563 | Corn Rhizosphere | VDRETARANIGAGLVAGGITAGIFALCFVAAMLYIAS* |
| Ga0068855_1021392791 | 3300005563 | Corn Rhizosphere | VDRETARRSMTAGLVAGGFAAAVFAACFIVALLYIAH* |
| Ga0070664_1000525304 | 3300005564 | Corn Rhizosphere | MDRETARRNMKAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0070664_1009189181 | 3300005564 | Corn Rhizosphere | VDRERARSNIAAGLLAGGIAAAVFALAFVAAVLYIAS* |
| Ga0068857_1016413371 | 3300005577 | Corn Rhizosphere | MDRETARRQLKAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0068854_10000008259 | 3300005578 | Corn Rhizosphere | MDRETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0068854_1008799722 | 3300005578 | Corn Rhizosphere | MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0068856_1005630382 | 3300005614 | Corn Rhizosphere | VDRETARAKMSAGLLAGGIVAAIFALCFVVAMLYVAS* |
| Ga0068856_1017879643 | 3300005614 | Corn Rhizosphere | VKIQLVDRRTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS* |
| Ga0068856_1026423722 | 3300005614 | Corn Rhizosphere | VDRETARRNMTAGLVAGGFAAVVFALCFIVALLYIAHG* |
| Ga0068852_1000009945 | 3300005616 | Corn Rhizosphere | MDRETARQNMRAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0068852_1014932113 | 3300005616 | Corn Rhizosphere | MDRQTGKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS* |
| Ga0068864_10000009075 | 3300005618 | Switchgrass Rhizosphere | VDRETARRDLKAGLLAGGIAAAVFALCFVVATLYIAS* |
| Ga0068866_100002066 | 3300005718 | Miscanthus Rhizosphere | MDRETARRDMAAGLLAGGVAAAVFALCFLAAMLYIAS* |
| Ga0068866_100166793 | 3300005718 | Miscanthus Rhizosphere | MDREAARKNMSSGLVAGGLAAAVFALCFVAAFLYIAQ* |
| Ga0066903_1082273542 | 3300005764 | Tropical Forest Soil | VDRETAKANMTAGLIAGGIAAAVFALTFVIAVLYIAS* |
| Ga0068851_100031124 | 3300005834 | Corn Rhizosphere | MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYVAG* |
| Ga0068863_1001212982 | 3300005841 | Switchgrass Rhizosphere | VDRETARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS* |
| Ga0068863_1005334181 | 3300005841 | Switchgrass Rhizosphere | VDRESAKRNIGAGLVAGGIAAGVFALSFVVAVLYI |
| Ga0068860_1000854785 | 3300005843 | Switchgrass Rhizosphere | VDRETARAKMNAGLLAGGIAAAIFALCFVAATLYVAS* |
| Ga0068860_1017741862 | 3300005843 | Switchgrass Rhizosphere | VDRESARASIATGLVAGGVAAAVFALSFVAAVLYIAS* |
| Ga0075287_10303032 | 3300005873 | Rice Paddy Soil | VDRESARASVSAGLVAGGIAAAIFALSFVAAVLYIAS* |
| Ga0075287_10374302 | 3300005873 | Rice Paddy Soil | VDRETARAKMSAGLLAGGIAAAIFALCFVAAMLYVAS* |
| Ga0081540_100055733 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MDRESARNNMVGGLVAGGFAAAIFALAFVAAALYLATS* |
| Ga0081540_12170422 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MDRESARANMSAGLVAGGIAAAVFALCFVAAMLYIAS* |
| Ga0075365_107493022 | 3300006038 | Populus Endosphere | VDRERARSNIGAGLLAGAIAAGVFALAFVVAVLYIAS* |
| Ga0070712_1008448683 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRETARRNITGGLVAGGFAAAIFALSFVVALLYIAQ* |
| Ga0097621_1009178311 | 3300006237 | Miscanthus Rhizosphere | MDREIARKNMGSGLVAGGLAAFVFALCFVAAFLYIAQ* |
| Ga0074055_118336542 | 3300006573 | Soil | MDRETARRDVAAGLLAGGIAAAVFALCFVAAMLYIAS* |
| Ga0074059_118443742 | 3300006578 | Soil | VDRETARKNMSAGLVAGGFAAAVFALSFVAAFLYIAQ* |
| Ga0074048_127165163 | 3300006581 | Soil | VDRETARKNMSAGLAAGGLAAAVFALAFVAAFLYIAQ* |
| Ga0074062_130269342 | 3300006606 | Soil | VDRETARAKMSAGLLAGGIAAAIFSLCFVAATLYVAS* |
| Ga0075527_100031114 | 3300006640 | Arctic Peat Soil | VDRETSRRDIRAGLVAGGFAAAVFGLCFVAAMLYIAS* |
| Ga0075527_100044853 | 3300006640 | Arctic Peat Soil | VDRETSKREMSAGLQAGAFAAAVFALCFVAAMLYIAS* |
| Ga0075521_104432422 | 3300006642 | Arctic Peat Soil | VDRETARKNMTAGLVAGGIAAAVFALSFVAAFLYIAQ* |
| Ga0079222_103500313 | 3300006755 | Agricultural Soil | SRNLAVDRETARANMTAGLVAGGIAAAVVALCFVVAMLYVAS* |
| Ga0079222_103783572 | 3300006755 | Agricultural Soil | MDRETARRNMRAGLIAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0079222_108103591 | 3300006755 | Agricultural Soil | MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYVAQ* |
| Ga0079222_120776892 | 3300006755 | Agricultural Soil | MDRESARQSMKAGLVAGGIAAGIFALSFVAAFLYIAS* |
| Ga0075530_11241521 | 3300006792 | Arctic Peat Soil | TVDRETSRRDMRAGLLAGGTAAAVFALCFVAAMLYIAS* |
| Ga0079221_114205342 | 3300006804 | Agricultural Soil | MDRDSARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA* |
| Ga0075421_1000521385 | 3300006845 | Populus Rhizosphere | VDRETARRRISAGFVAGAFAASVFALCFVVAVLYIAQ* |
| Ga0075430_1002063204 | 3300006846 | Populus Rhizosphere | VDRKTSRANISAGLLAGGIGAAIFALCFVAAVLYIAS* |
| Ga0075420_1001840893 | 3300006853 | Populus Rhizosphere | VDRETARKNMSAGLVAGGFAAAVFALAFVAAFLYIAQG* |
| Ga0075425_1000725002 | 3300006854 | Populus Rhizosphere | VDRESARKNMSGGLLLGGFATAIFALSFVAAFLYIAGA* |
| Ga0075425_1002479355 | 3300006854 | Populus Rhizosphere | PVDRESARANMSAGLLAGGIATAVFALCFVAAMLYIAS* |
| Ga0075425_1006256373 | 3300006854 | Populus Rhizosphere | VDRDRARSNIATGLLAGAIAAGVFALAFVVAVLYIAS* |
| Ga0079217_111786832 | 3300006876 | Agricultural Soil | VDRESARRNLSTGFLVGAIAAGVFALSFVAAMLYIAS* |
| Ga0068865_1015619113 | 3300006881 | Miscanthus Rhizosphere | MDRDSARRQLSAGLLAGGIAAGIFALSFVAAFLYIAA* |
| Ga0068865_1020778372 | 3300006881 | Miscanthus Rhizosphere | GPPDRNPAVDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ* |
| Ga0075424_1006200862 | 3300006904 | Populus Rhizosphere | MDRETARRNMRAGLFAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0074063_129075981 | 3300006953 | Soil | MDRESARKNMAAGLVAGGFAAAVFALCFVAAFLYI |
| Ga0079219_121220123 | 3300006954 | Agricultural Soil | GLMDRDSARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA* |
| Ga0102946_100009410 | 3300007614 | Soil | VDRETARKNMSSALVAGGFAAAVFALAFVAAFLYIAQA* |
| Ga0102946_10056867 | 3300007614 | Soil | VDRETSRRDIRAGLLAGGIAATVFGLSFVAAMLYIAS* |
| Ga0102949_10054074 | 3300007757 | Soil | VDRETSKREMAAGLQAGAFAAAVFALCFVAAMLYIAS* |
| Ga0105251_105986561 | 3300009011 | Switchgrass Rhizosphere | VDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG* |
| Ga0105240_112947402 | 3300009093 | Corn Rhizosphere | VDRETARKNMSSGLVAGGFAAAVFALCFVAAFLYIAQ* |
| Ga0105245_100382382 | 3300009098 | Miscanthus Rhizosphere | MDRETARRNMRAGLVAGGIAAGIFALSFAAAFLYIAQ* |
| Ga0105247_1000013145 | 3300009101 | Switchgrass Rhizosphere | VDRESARKNMTAGLVAAGFATGIFALTFVAALFYIAQG* |
| Ga0115923_101595764 | 3300009112 | Swimming Pool Sandfilter Backwash | VDRETARKNMSAGLVAGGFATAVFALAFVAAFLYIAQG* |
| Ga0114129_123164122 | 3300009147 | Populus Rhizosphere | VDREQARKNVGAGLMLGAFAAAIFALSFVAALLYIAQ* |
| Ga0111538_106549554 | 3300009156 | Populus Rhizosphere | DRNRFVDRETARRRISAGFVAGAFAASVFALCFVVAVLYIAQ* |
| Ga0111538_139787212 | 3300009156 | Populus Rhizosphere | MDRETARRQMRAGLVAGGIAAGIFALSLVAAFLYIAQ* |
| Ga0075423_103726782 | 3300009162 | Populus Rhizosphere | VDRETSRRDLKAGLLAGGFAAAVFALCFVAATLYIAS* |
| Ga0105241_101164295 | 3300009174 | Corn Rhizosphere | MDRETARRQMSAGLVAGGIAAGIFALSFVAAFLYIAA* |
| Ga0105242_1000042833 | 3300009176 | Miscanthus Rhizosphere | VDRETARKNMTAGLVAAGLATGIFALTFVAALFYIAQG* |
| Ga0105242_106321942 | 3300009176 | Miscanthus Rhizosphere | VDRETARRNMTAGLVAGGFAAAVFALCFVVALLYIAH* |
| Ga0105242_112938363 | 3300009176 | Miscanthus Rhizosphere | AVDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAHG* |
| Ga0105237_102572203 | 3300009545 | Corn Rhizosphere | MDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAH* |
| Ga0105238_10000033126 | 3300009551 | Corn Rhizosphere | MDRESARANMSAGLVAGGIAAAIFALCFVAAMLYVAS* |
| Ga0105238_104762634 | 3300009551 | Corn Rhizosphere | MDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG* |
| Ga0105249_1000021837 | 3300009553 | Switchgrass Rhizosphere | VDRETAKANMVAGLVAGGIAAAIFALCFVAAMLYIAS* |
| Ga0105249_107381022 | 3300009553 | Switchgrass Rhizosphere | VDRETARKNLGAGLVAGGLAAAVFALCFVAAFLYIAQ* |
| Ga0105249_110344531 | 3300009553 | Switchgrass Rhizosphere | TARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS* |
| Ga0105249_113989911 | 3300009553 | Switchgrass Rhizosphere | ANRGAARTDRNPAVDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG* |
| Ga0105340_13210082 | 3300009610 | Soil | VDRETTKRSITAGLMAGGVAAAIFALSFVVAMLYIAA* |
| Ga0126307_100371193 | 3300009789 | Serpentine Soil | VDRETARRSISTGLLAGGIAAAVFALTFVAAVLYIAS* |
| Ga0126307_109950312 | 3300009789 | Serpentine Soil | VDRESARRNIATGLLAGAIAASVFALSFVAAVLYIAS* |
| Ga0126307_117083301 | 3300009789 | Serpentine Soil | VDRESARRNIASGLLAGAVAAGVFALAFVAAVLYIAS* |
| Ga0126313_102726243 | 3300009840 | Serpentine Soil | VDRETARRSISTGLLAGGIAAAVFALTFVVAVLYIAS* |
| Ga0126313_102800023 | 3300009840 | Serpentine Soil | MDRETARKNMGAGLVAGGFAAAIFALCFVAAFLYIAQ* |
| Ga0131092_101789963 | 3300009870 | Activated Sludge | MDRETERRSIGGGLVIGAIAAAMFALAFLAAMLYIAP* |
| Ga0131092_104014992 | 3300009870 | Activated Sludge | MDRESAKQSIGGGLVIGAIAAAMFALAFLAAMLYIAP* |
| Ga0126305_101047452 | 3300010036 | Serpentine Soil | MDRESARRQLRAGLVTGGIAAGIFALSFVAAFLYIAQ* |
| Ga0126304_101672263 | 3300010037 | Serpentine Soil | MDRDTARRNMKAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0126304_108263202 | 3300010037 | Serpentine Soil | VDRETARSSVSAGLLAGGIAAAVFALSFLAAVLYIAS* |
| Ga0126309_1000001742 | 3300010039 | Serpentine Soil | VDREHARRNLGQGLILGVVAAGIFALSFFAAMIYIAA* |
| Ga0126314_110890251 | 3300010042 | Serpentine Soil | GRNPAVDREDARRNIATGLLAGAIAASVFALSFVVAILYIAS* |
| Ga0126380_108821441 | 3300010043 | Tropical Forest Soil | HPVDRETARRNMSAGLVAGGFAAMIFALCFIVALLYIAH* |
| Ga0126310_111174762 | 3300010044 | Serpentine Soil | VDRETARRNLSAGLLYGGIAAAVFALCFIASILYIA* |
| Ga0126311_100031298 | 3300010045 | Serpentine Soil | VDREDARRNIATGLLAGAIAASVFALSFVVAVLYIAS* |
| Ga0126311_101390892 | 3300010045 | Serpentine Soil | VDRENARRNIVSGLLAGAIAAGVFALAFVVAVLYIAS* |
| Ga0126311_102581632 | 3300010045 | Serpentine Soil | VDRETSRKNMSAGLVAGGFAAAIFALCFVAAFLYIAQA* |
| Ga0126311_113233612 | 3300010045 | Serpentine Soil | MDRESARRNISTGLLAGGIAAAIFALSFVAAVLYIAS* |
| Ga0126382_110542153 | 3300010047 | Tropical Forest Soil | VDRDLAKKNMSAGLVAGGIAAAVFALTFVAAVLYIAS* |
| Ga0133939_10719453 | 3300010051 | Industrial Wastewater | VDRESARANLISGLVTGGLAALVFALCFVAAALYLATQ* |
| Ga0126306_101898772 | 3300010166 | Serpentine Soil | MDRETARRNVKAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0126306_103957993 | 3300010166 | Serpentine Soil | MDRETARKNMSSGLVAGGFAAAVFALCFVAAFLYIAQ* |
| Ga0134086_103320472 | 3300010323 | Grasslands Soil | VDRDTARAGISAGLLAGGIAAAVFALSFVAAVLYIAS* |
| Ga0126376_119242541 | 3300010359 | Tropical Forest Soil | VDRESARKNMSAGLVAGGLATGVFALCFVTALLYIAA* |
| Ga0126372_124883062 | 3300010360 | Tropical Forest Soil | VDRETARRNMTAGLVAGGFAASVFALCFIVALLYIAH* |
| Ga0126377_103100663 | 3300010362 | Tropical Forest Soil | MDRETARANMGAGLLAGGIAATVFALCFVVAMLYVAS* |
| Ga0134125_130490011 | 3300010371 | Terrestrial Soil | KSHFMDREVARKNMSSGLVAGGLAAAVFALCFIAAFLYIAQ* |
| Ga0134128_114760052 | 3300010373 | Terrestrial Soil | VDRELARRNLSAGLLAGGVAAAVFALCFVAAFIYIAS* |
| Ga0134128_120689872 | 3300010373 | Terrestrial Soil | VDRELARRNMKGGLLAGGIAVAVFALSFVAAMLYIAS* |
| Ga0105239_104873712 | 3300010375 | Corn Rhizosphere | MDRETARKNMSAGLVAGGFAAAIFALSFVVAFLYIAQ* |
| Ga0134126_100332545 | 3300010396 | Terrestrial Soil | VDRETARRNMTAGLVAGGFAAMIFALCFIVALLYIAH* |
| Ga0134122_129277153 | 3300010400 | Terrestrial Soil | MDRETAKANMTAGLVAGGIAAGIFALTFVVAVLYIAS* |
| Ga0134123_100836015 | 3300010403 | Terrestrial Soil | VDREASRASIAAGLTAGGIVAAIFALCFVAAVLYIAS* |
| Ga0134123_101617894 | 3300010403 | Terrestrial Soil | VDRETARAKMSAGLVAGGIAAAVFALCFVAAMLYVAS* |
| Ga0105246_110246242 | 3300011119 | Miscanthus Rhizosphere | VDRERARSNIATGLLAGAIAAGIFALTFVVAVLYIAS* |
| Ga0153954_11425211 | 3300011418 | Attine Ant Fungus Gardens | KTGETDRNPPVDRETARRNMTAGLIAGGFSAVVFALCFIVALLWIAH* |
| Ga0120159_10770783 | 3300012014 | Permafrost | VDRETARRNMSAALVAGGFAAAIFALAFVVALLYIAQ* |
| Ga0137421_11562822 | 3300012039 | Soil | VDRETSRRDIAAGLLAGGIAAGVFALCFLAAMLYIAS* |
| Ga0153956_100171311 | 3300012090 | Attine Ant Fungus Gardens | VDRETARRNMTAGLVAGGFAATVFGLCFIVALLYIAHG* |
| Ga0137365_104258722 | 3300012201 | Vadose Zone Soil | VDRESARANMTAGLLAGGVAAAIFALCFVAAMLYIAS* |
| Ga0150985_1004172823 | 3300012212 | Avena Fatua Rhizosphere | ETSRRDMAAGLLAGGIAAAIFALCFVAATLYIAS* |
| Ga0150985_1036695124 | 3300012212 | Avena Fatua Rhizosphere | ETARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0150985_1143968833 | 3300012212 | Avena Fatua Rhizosphere | SDLETARRNMRAGLVAGGIAAGVFALSFVAAFLYIAQ* |
| Ga0150985_1160190572 | 3300012212 | Avena Fatua Rhizosphere | VDRESARKNMTAGLLAAGFATGIFALTFVAALFYIAQG* |
| Ga0150985_1209760481 | 3300012212 | Avena Fatua Rhizosphere | ISMDRQTARKNMTGGLVAAGFATAVFALSFVAAFLYIAQG* |
| Ga0137371_100122717 | 3300012356 | Vadose Zone Soil | VDRETARLNMSAGLLAGGFAAAIFALCFVAAMLYIAS* |
| Ga0150984_1041217351 | 3300012469 | Avena Fatua Rhizosphere | ETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0150984_1055594613 | 3300012469 | Avena Fatua Rhizosphere | MDRQTARKNMTGGLVAAGFATAVFALSFVAAFLYIAQG* |
| Ga0150984_1159826191 | 3300012469 | Avena Fatua Rhizosphere | ETARRNMRAGLVAGGIAAGVFALSFVAAFLYIAQ* |
| Ga0157309_103057332 | 3300012895 | Soil | VDRETARKNMSAGLLAGGLAAAVFALCFIAAFLYIAQ* |
| Ga0157292_10000006115 | 3300012900 | Soil | MDRETARKNMGAGLVAGGLAAAVFALCFVAALLYIAQ* |
| Ga0157292_100685762 | 3300012900 | Soil | VDRETAKRNLTAGLIAGGFATAIFALSFVAALLYIAS* |
| Ga0157283_100008252 | 3300012907 | Soil | MDRETARRNMRAGLVAGGIAAGVFALSFVAAFLYIAQ* |
| Ga0157286_103101342 | 3300012908 | Soil | MDRETARRNMPAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0157290_100006613 | 3300012909 | Soil | MDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA* |
| Ga0157298_10000004127 | 3300012913 | Soil | VDRETSKRQISAGLVAGGFAAAIFALCFVAATLYIAS* |
| Ga0157297_102419682 | 3300012914 | Soil | VDRERARSNIAAGLLAGGIAAGVFALAFVVAVLYIAS* |
| Ga0157302_102257471 | 3300012915 | Soil | VDRESARRNIATGLIAGGIAAAVFALSFVAAVLYIAS* |
| Ga0137413_102592882 | 3300012924 | Vadose Zone Soil | VDRESARKNMTAGLVAGGVAAAVFALSFVAAFLYIAQ* |
| Ga0137413_118040391 | 3300012924 | Vadose Zone Soil | TDRNPAVDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH* |
| Ga0137404_108630963 | 3300012929 | Vadose Zone Soil | VDRETARANMSAGLLAGGIAAAVFALCFVAAMLYIAS* |
| Ga0162650_1000003002 | 3300012939 | Soil | MDRESARRQMSAGLLAGGIAAGIFALSFVAAFLYIAA* |
| Ga0164242_103622932 | 3300012942 | Compost | VDRETARRNMTAGLIAGGFSALVFALCFIVALLYIAHG* |
| Ga0164242_106123861 | 3300012942 | Compost | VDRETARRNMTAGMIAGGFAAVVFALCFIVALLYIAHG* |
| Ga0164241_1000152421 | 3300012943 | Soil | MPLIEIPVVDRETARKNMGAGLVAGAFAAVIFALCFVAAFLYIAQ* |
| Ga0164241_100170165 | 3300012943 | Soil | MDRETARKNMSSGLVAGGIAASVFALCFIAAFLYIAQ* |
| Ga0164241_100366453 | 3300012943 | Soil | VDRETAKASMSAGLVAGGIATAIFALCFVAAMLYIAS* |
| Ga0137410_112512742 | 3300012944 | Vadose Zone Soil | MDRETARKNMSSGLVVGGFAAAIFALSFVVAILYIAQ* |
| Ga0126375_120473341 | 3300012948 | Tropical Forest Soil | MDRERAGRNISAGLVAAGFAAALFALCFVAAFLYIAQ* |
| Ga0164300_103417292 | 3300012951 | Soil | VDRERARSNIAAGLLAGAIAAGVFALAFVVAVLYIAS* |
| Ga0164298_101632832 | 3300012955 | Soil | MDRETARRQLGAGLVAGGIAAGIFALSFVAAFLYIAA* |
| Ga0164298_107234042 | 3300012955 | Soil | VDRETARRNMGAGLVAGGLAAAVFALAFVAALLYIAQ* |
| Ga0164298_114200562 | 3300012955 | Soil | MDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ* |
| Ga0164298_116385861 | 3300012955 | Soil | VDRERARSNIATGLLAGAIAAGVFALTFVVAVLYIAS* |
| Ga0164303_110963382 | 3300012957 | Soil | VDRETAKRNMAAGLWAGGIAAAVFALCFVVAFIYIAS* |
| Ga0164299_100226715 | 3300012958 | Soil | MDRENARRQMKAGLVAGGIAAGIFALSFFAAFLYLAGS* |
| Ga0164299_107061242 | 3300012958 | Soil | VDRETAKRRISAGFVAGAFAASVFALSFVVAVLYIAQ* |
| Ga0164299_112373541 | 3300012958 | Soil | RENARRQMKAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0164308_106054551 | 3300012985 | Soil | MDRESARQSMRAGLVAGGIAAGIFALSFVAAFLYIAS* |
| Ga0164308_116604722 | 3300012985 | Soil | VDRERARSNISTGLLAGSIAAGVFALTFVVAVLYIAS* |
| Ga0164304_110993551 | 3300012986 | Soil | VDRETARNNMAAGLVAAGFATAIFALAFVVALFYIAQ* |
| Ga0164307_100346472 | 3300012987 | Soil | MDRESSRAGLKAGLVAGGIAAGIFALSFVAAFLYIAS* |
| Ga0164307_106079991 | 3300012987 | Soil | RSSGRNPPVDRDRARSNIATGLLAGAIAAGVFALAFVVAVLYIAS* |
| Ga0164307_109684123 | 3300012987 | Soil | VDRETARKNMAAGLVAGGFAAAIFALAFVAAFLYIAQ* |
| Ga0164305_112210801 | 3300012989 | Soil | VDRESARRNISTGLLAGGFAAAVFALAFVAAVLYIAS |
| Ga0157370_101260052 | 3300013104 | Corn Rhizosphere | VDRETSRRDIAAGLVAGGIAAAIFALCFVAATLYIAS* |
| Ga0157378_100161782 | 3300013297 | Miscanthus Rhizosphere | MDRETARLQMRAGLVAGGIAAGIFALSFVAAFLYIAQ* |
| Ga0157378_101493384 | 3300013297 | Miscanthus Rhizosphere | MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYIAA* |
| Ga0157378_110463792 | 3300013297 | Miscanthus Rhizosphere | MDRESARANMSAGLVAGGIATAVFALCFVAAMLYIAS* |
| Ga0163162_112176872 | 3300013306 | Switchgrass Rhizosphere | MDRQTARKNMSSGLIAGGFAAAIFALCFVAAFLYIAQ* |
| Ga0157375_1000941411 | 3300013308 | Miscanthus Rhizosphere | MDRETARKNMGAGLVAGGFAAAVFALCFVAAFLYIAQ* |
| Ga0157375_125146163 | 3300013308 | Miscanthus Rhizosphere | VDRETSRASIAAGLTAGGIVAAIFALCFVAAVLYIAS* |
| Ga0157375_129544151 | 3300013308 | Miscanthus Rhizosphere | MDRENARANMSAGLVAGGIAAGIFALCFVVAMLYIAS* |
| Ga0120158_103107502 | 3300013772 | Permafrost | VDRETARRNMSAALVAGGFAAAIFALSFVVALLYIAQ* |
| Ga0075312_11284461 | 3300014254 | Natural And Restored Wetlands | VDRESARKNMSAGLVAGGLAAAVFALCFVVALLYVAQ* |
| Ga0075312_11346432 | 3300014254 | Natural And Restored Wetlands | VDRESARRNISTGLLAGGIAASIFALAFVAALLYIAS* |
| Ga0075320_10349711 | 3300014255 | Natural And Restored Wetlands | VDRETTRANVGAGLSAAGIAVAIFALCFVVAMLYIAS* |
| Ga0075311_10235982 | 3300014259 | Natural And Restored Wetlands | VDRETARANIGAGLVAGGIAAAVFALCFVAATLYIAS* |
| Ga0075324_1000003184 | 3300014263 | Natural And Restored Wetlands | MDRETARRNIGAGLMLGGFAAAIFALSFVAAILYIAQ* |
| Ga0075313_12073042 | 3300014267 | Natural And Restored Wetlands | VDRETARRNMAAGLLAGGIAASVFALCFIAAVLYIAS* |
| Ga0075325_100006211 | 3300014270 | Natural And Restored Wetlands | VDRETSRANISAGLLAGGIATAIFALCFVAAMLYIAS* |
| Ga0075325_10151083 | 3300014270 | Natural And Restored Wetlands | VDRETSRRDLRAGLLAGGIAAAVFALCFVVATLYIAS* |
| Ga0075325_11047962 | 3300014270 | Natural And Restored Wetlands | MDRETSRKDIAAGLIAGGLAAAVFALCFIAATLYIAS* |
| Ga0075326_12593712 | 3300014271 | Natural And Restored Wetlands | VDRETSKRQITAGLVAGGFAAAVFALCFVAATLYIAS* |
| Ga0075303_10030192 | 3300014299 | Natural And Restored Wetlands | VDRETTRANVAAGLSAAGIAVTIFALCFVAAMLYVAS* |
| Ga0075321_10691773 | 3300014300 | Natural And Restored Wetlands | DRNPPVDRETSRRDMTAGLLAGGIAAAIFALCFVAATLYIAS* |
| Ga0075323_11210382 | 3300014301 | Natural And Restored Wetlands | VDRESARANITAGLVAGGIAVGVFALCFVVAMLYIAS* |
| Ga0075322_10003443 | 3300014311 | Natural And Restored Wetlands | VDRESARANISAGLVAGGIAATIFALCFVAAMLYIAS* |
| Ga0075316_10210651 | 3300014314 | Natural And Restored Wetlands | VDRETARANISAGLVAGGIAAAIFALCFVAAMLYIAS* |
| Ga0163163_102783874 | 3300014325 | Switchgrass Rhizosphere | VDRESARASISAGLVAGGVAAAVFALSFVAAVLYIAS* |
| Ga0163163_102890462 | 3300014325 | Switchgrass Rhizosphere | VDRETAKRNLTAGLLAGGIATAVFALSFVAALFYIAS* |
| Ga0163163_115936312 | 3300014325 | Switchgrass Rhizosphere | VDRETARRDLAAGLLAGGIAAGVFTLCFVVAVLYIAS* |
| Ga0157380_1000134312 | 3300014326 | Switchgrass Rhizosphere | VDRETARSSISAGLLAGGIAAAVFALSFLAAVLYIAS* |
| Ga0182000_100084002 | 3300014487 | Soil | VDRETSRRDIRAGLLAGGFAAAVFALCFVAATLYIAS* |
| Ga0182019_101039384 | 3300014498 | Fen | VDRETARKNMTGGLVAGGFAAAIFALAFVAAFLYIAQ* |
| Ga0157377_102065522 | 3300014745 | Miscanthus Rhizosphere | VDRETARKNMSSGLVAGGFAAAVFALCFVVAFLYIAQ* |
| Ga0157379_100885275 | 3300014968 | Switchgrass Rhizosphere | VDRETAKGNMVAGLVAGGIAAAVFALCFVAAMLYIAS* |
| Ga0157379_107121001 | 3300014968 | Switchgrass Rhizosphere | PDRNPTVDRETARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS* |
| Ga0157376_100781253 | 3300014969 | Miscanthus Rhizosphere | MDRETARRNMRAGLVAGGVAAGIFALSFVAAFLYIAQ* |
| Ga0167633_1145153 | 3300015069 | Glacier Forefield Soil | VDRETARKNMTAGLVAGGFAAGVFALCFIAAFLYIAQS* |
| Ga0167632_10218612 | 3300015085 | Glacier Forefield Soil | VDRETSRRDIAAGLMAGGIAAAIFALCFVAAALYIAQ* |
| Ga0167643_10311211 | 3300015089 | Glacier Forefield Soil | VDRETARRNMTAGLVAGGFAAMVFALCFIVALLSIAH* |
| Ga0167634_10036102 | 3300015090 | Glacier Forefield Soil | MDRETSRRNMAAGLVAGGIAAAIFALCFVAATLYIAS* |
| Ga0173480_109311172 | 3300015200 | Soil | VDRETARRRIGAGFVAGAFAASVFALCFVVAVLYIAQ* |
| Ga0137412_109627011 | 3300015242 | Vadose Zone Soil | VDREVARKNMSAGLLAGGFAVAIFALSFVAAFLYIAQ* |
| Ga0137412_110388311 | 3300015242 | Vadose Zone Soil | VDRESARKNMTAGLLAAGFATGIFALTFVAALLYIAQG* |
| Ga0132258_110611575 | 3300015371 | Arabidopsis Rhizosphere | VDRETARKNMSAGLVAGGFAAAIFALCFVAAFLYVAQ* |
| Ga0163161_100084462 | 3300017792 | Switchgrass Rhizosphere | MDRETARKNMGSGLMVGGFAAAIFALCFVAAFLYIAQ |
| Ga0187825_101253592 | 3300017930 | Freshwater Sediment | MDRQTARANMTAGLVAGGIAAAIFALSFVVAVLYIAS |
| Ga0190266_100745562 | 3300017965 | Soil | VDRETARKNMSAGLVAGGFAAAVFALAFVAAFLYIAQG |
| Ga0184611_12178182 | 3300018067 | Groundwater Sediment | MDRETARRNMKAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0184618_101592152 | 3300018071 | Groundwater Sediment | VDRDTARRNIGAALLAGAIAASVFALSFVVAVLYIAS |
| Ga0190265_1000006320 | 3300018422 | Soil | MDRETARRNMTSALVAGGIAAAIFALCFVAATLYIAS |
| Ga0190265_100548134 | 3300018422 | Soil | VDRETSRKDIGAGLLAGAIAAGVFALSFLAAMLYIAS |
| Ga0190265_100871033 | 3300018422 | Soil | VDRETARRNLTSALVLGGVAATIFALCFVAATLYIAS |
| Ga0190265_101484504 | 3300018422 | Soil | MDRETARRSMSAGLVAGGIAVGVFALCFVTAFIYIAQ |
| Ga0190272_100110784 | 3300018429 | Soil | VDRESAKQNMSAGLLAGGIAASVFALCFVAAMLYIAS |
| Ga0190272_101477314 | 3300018429 | Soil | VDRETAKANMSAGLLAGGIAATVFALCFVAAMLYIAS |
| Ga0190272_102524732 | 3300018429 | Soil | MDRETARKNMAGGLVAAGFATAVFALCFVAAFLYVAQ |
| Ga0190272_103870942 | 3300018429 | Soil | MDRETARKNMSTGLVAGGLAAAVFALCFVAAFLYIAQ |
| Ga0066655_101639671 | 3300018431 | Grasslands Soil | MDRETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0190275_1000030414 | 3300018432 | Soil | MDRENARRQISAGLITGGIAAGVFALCFVTAFVYIAG |
| Ga0190275_1000349913 | 3300018432 | Soil | VDRETARKNMSSGLVAGGFAAAVFALCFVAAFLYIAQ |
| Ga0190275_113002422 | 3300018432 | Soil | VDRETARRNLSSGLLYGGIAAAIFALCFLASILYIA |
| Ga0190275_117588712 | 3300018432 | Soil | VDRDTARRNLSAGLLYGGIAAAIFGLCFIASILYIA |
| Ga0190275_120095332 | 3300018432 | Soil | VDRETARKNMSAGLVAGGFAAAVFALCFVAAFLYIAQ |
| Ga0190269_1000106711 | 3300018465 | Soil | MDRETARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0190268_102257373 | 3300018466 | Soil | VDRETARRNLTAGLLYGGIAAAVFALCFIASILYIA |
| Ga0190270_100262363 | 3300018469 | Soil | VDRETARRNMTAGLLYGGIAAAVFALCFIASILYIA |
| Ga0190270_100719191 | 3300018469 | Soil | MDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA |
| Ga0190270_105604053 | 3300018469 | Soil | VDRELAKRNMSAGLLAGAIAAALFALAFLAAVLYIAS |
| Ga0190270_109380551 | 3300018469 | Soil | VDRETARKNMSSGLFAGAFVAAVFALSFVAAFLYIAQ |
| Ga0190270_120338862 | 3300018469 | Soil | VDRETARRNISAGLLAGGIAATIFALSFVAAVLYIAS |
| Ga0190274_1000003731 | 3300018476 | Soil | VDRETSRKNIGAGLLAAGLAAGVFALCFVAALLYIAQ |
| Ga0190274_1000064723 | 3300018476 | Soil | VDRETARANIGAGLVAGGIAAAIFALCFVAAMLYIAS |
| Ga0190274_100652042 | 3300018476 | Soil | VDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYVAQ |
| Ga0190274_102795271 | 3300018476 | Soil | PCLPDRNPPVDRETAKRDMGAGLLAGGIAAGVFALCFVAAMLYIAS |
| Ga0190271_10000013107 | 3300018481 | Soil | VDRELAKRNLSSGLLAAAIAAALFALAFLAAVLYIAS |
| Ga0190271_1000015737 | 3300018481 | Soil | VDRETARKNMAAGLVAAGFATAIFALAFVVALFYIAQ |
| Ga0190271_100236579 | 3300018481 | Soil | MDRENARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ |
| Ga0190271_100373265 | 3300018481 | Soil | MDRESARRQLSAGLLAGGIAAGIFALSFVAAFLYIAA |
| Ga0190271_109123052 | 3300018481 | Soil | MDRENARRQMKAGLVAGGIAAGIFALSFVAAFLYIAGS |
| Ga0190273_1000001879 | 3300018920 | Soil | MDRETARRNMRAGLVAGGIAAGVFALAFVAAFLYIAQ |
| Ga0190273_102120133 | 3300018920 | Soil | MDRETARRQMRAGLVTGGIAAGIFALSFVAAFLYIAQ |
| Ga0190273_104970743 | 3300018920 | Soil | MDRETARRNMKAGLLAGGIAAGVFALSFVAAFLYIAQ |
| Ga0190273_113854352 | 3300018920 | Soil | MDRESSRRNLSAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0190264_102509962 | 3300019377 | Soil | VDRETARKNMSAGLVAGGLAAAVFALCFVAAFLYIAQ |
| Ga0190264_106149102 | 3300019377 | Soil | VDRESARKNMSAGLVAGGFAAAIFALAFVAAFLYIAQG |
| Ga0193701_11004032 | 3300019875 | Soil | MDRETARRQMKAGLVTGGIAAGIFALSFVAAFLYIAQ |
| Ga0193707_10881641 | 3300019881 | Soil | VDREAARKNMSAGLVAAGLAAAVFALCFIAAFLYIAQ |
| Ga0193741_10164873 | 3300019884 | Soil | VDRETSKANISAGLMAGGIAAAVFALCFVAAMLYIAS |
| Ga0193743_10018909 | 3300019889 | Soil | VDRETARKNMGAGLVAGGLAAAVFALCFVVAFLYIAQ |
| Ga0193697_10694862 | 3300020005 | Soil | MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0193738_10344774 | 3300020020 | Soil | MDRETARKNMGAGLVAGGLAAAVFALCFVAAFLYIAQ |
| Ga0193726_10476004 | 3300020021 | Soil | VDRESARKNMTAGLVAGGVAAAVFALSFVAAFLYIAQ |
| Ga0193726_10504771 | 3300020021 | Soil | PCLPDRNPPVDRETSRRDMAAGLLAGGIAAAIFALCFLAATLYIAS |
| Ga0193733_11023603 | 3300020022 | Soil | VDRETARKNMAGGLAAGGFAAAIFALSFVVALLYIAQ |
| Ga0193753_100761774 | 3300020034 | Soil | VDRETARKNMSAGLLVGSFAAAIFALSFIVAFLYIA |
| Ga0193753_101161834 | 3300020034 | Soil | VDRETARRNMTAGLVAGGFAAVVFALCFIVALLYIAH |
| Ga0193745_10247863 | 3300020059 | Soil | MDRETSRRDMAAGLVAGGIAAAIFALCFVAATLYIAS |
| Ga0197907_108708753 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | DRNQGVDRETARRNMTAGLVAGGFAAAIFALCFIVALLWIAH |
| Ga0206356_106666275 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRETARRNLSAGLLAGGIATAVFALCFVAGFLYIAQ |
| Ga0206351_104083911 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | RETARRSMTAGLVAGGFAAMVFAACFIVALLYIAH |
| Ga0196965_11662142 | 3300020154 | Soil | VDRETARKNMSAGLVAGAFAASVFSLAFVAALLYIAQ |
| Ga0196958_1000219810 | 3300020181 | Soil | MDRESARRSLSAGLVTGGIAAGIFALSFVAAFLYIAQ |
| Ga0196958_101435983 | 3300020181 | Soil | MDRETARRSMSAGLVAGGIAAGVFALCFVTAFIYIAQ |
| Ga0196958_102122462 | 3300020181 | Soil | MDRENARRQLSAGLVTGGIAAGVFALCFVAAFLYIAQ |
| Ga0154015_15409692 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRQSARNSMRAGLIAGGIAAGIFALSFVAAFLYIAS |
| Ga0179596_106382891 | 3300021086 | Vadose Zone Soil | VDRETARRNMTAGLVAGGFAALVFALCFIVALLYIAH |
| Ga0193706_10070935 | 3300021339 | Soil | VDRETVRKNIGAGLFAGALAAAVFALCFVAAFLYVA |
| Ga0193706_10123902 | 3300021339 | Soil | VDRETARKNMSGALVVGGLAAAVFALCFVAAFLYIAQ |
| Ga0193706_10530224 | 3300021339 | Soil | MDRETSRKNMTGGLVAAGFATAIFALSFVAAFLYIAQG |
| Ga0193699_101195042 | 3300021363 | Soil | MDRETARRQMKAGLVAGGIAAGVFALSFVAAFLYIAA |
| Ga0210393_102957003 | 3300021401 | Soil | MDRETARKNMIGGLMAGGFAAAIFALAFVVAFLYIAQ |
| Ga0210397_100855662 | 3300021403 | Soil | VDRETARRNMTAGLVAGGFAATVFALCFIVALLYVAH |
| Ga0193736_10579872 | 3300021412 | Soil | VDRETARKNMGAGLFAGAFVAAIFALCFIVAFLYIAQ |
| Ga0182009_106417612 | 3300021445 | Soil | VDRETARRNLTAGLVAGGIAAAVFALSFVAAVLYIAS |
| Ga0210409_100100533 | 3300021559 | Soil | VDRETARRKMSAGLVAGGLAAAVFALSFLVALLYIAQ |
| Ga0126371_109362242 | 3300021560 | Tropical Forest Soil | MDRESARNSMRAGLIAGGIAAGIFALSFVAAFLYLAS |
| Ga0222622_100490225 | 3300022756 | Groundwater Sediment | VDRETARRNMIGGLVAGGFAAAIFALSFVVALLYIAQ |
| Ga0222622_106037691 | 3300022756 | Groundwater Sediment | GRNPPVDRESARRNMGAGLVAGGIAAGIFALSFLVAVLYIAS |
| Ga0247792_10111583 | 3300022880 | Soil | MDRETARRNMRAGLVTGGIAAGIFALSFVAAFLYIAQ |
| Ga0247795_100012813 | 3300022899 | Soil | MDRETARRNLSAGLVTGGIAAGVFALCFVAAFLYIAQ |
| Ga0247768_100001626 | 3300022910 | Plant Litter | MDRETARQNMRAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0247743_10020444 | 3300023067 | Soil | MDREQARASVSAGLVAGLVAAAVFALCFVAAMLYIAS |
| Ga0247754_10007523 | 3300023102 | Soil | VDRETAKRNISGGLLAGGIAAGVFALCFVVAMLYIAS |
| Ga0247780_100144310 | 3300023265 | Plant Litter | MDRETARRNISSGLFAGALAASVFALCFVAALLYIAQ |
| Ga0247789_10105513 | 3300023266 | Soil | MDRETARRSLRAGLVAGGIAAGVFALAFVTAFLYIAQ |
| Ga0247789_10565552 | 3300023266 | Soil | MDRETARRSMSAGLVAGGIAVGVFALCFVTAFVYIAQ |
| Ga0247765_10053252 | 3300023268 | Plant Litter | MDRETARRQMSAGLVAGGIAAGIFALSFVAAFLYIAA |
| Ga0247776_1000028111 | 3300023275 | Plant Litter | MDRETARRQMGAGLVAGGIAAGIFALSFVAAFLYIAA |
| Ga0247794_100635502 | 3300024055 | Soil | MDRETARTNMRAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0179591_11808833 | 3300024347 | Vadose Zone Soil | VDRETARKNMSAGLLAGGLAAAVFALAFVAALLYIAQ |
| Ga0196960_100005794 | 3300024426 | Soil | MDRETARKNMSAGLTAGGIAAGVFALCFVTAFIYIAG |
| Ga0196960_100637853 | 3300024426 | Soil | MDRESARKNISAGLVAGGIAVGIFALAFVTAFIYIAQ |
| Ga0196962_1000025915 | 3300024430 | Soil | VDRETARKNMGAGLLAGGIAAAVFALSFVAALLYIA |
| Ga0209916_10009511 | 3300024996 | Wastewater Bioreactor | VDRETARRNMTAGLVAGGFAAVVFALCFIVALLYIAHG |
| Ga0207656_100174124 | 3300025321 | Corn Rhizosphere | MDRETARRQMKAGLVAGGIAAGIFALSFVAAFLYVAG |
| Ga0208356_100000577 | 3300025504 | Arctic Peat Soil | MDRETARKNMVGGLVAGGFAAAIFALAFVVAFLYIAQ |
| Ga0207423_10098371 | 3300025535 | Natural And Restored Wetlands | SRTRAVDRETTRANVAAGLSAAGIAVTIFALCFVAAMLYVAS |
| Ga0210132_10001392 | 3300025538 | Natural And Restored Wetlands | VDRETTRANVAAGLSAAGIAVTIFALCFVAAMLYVAS |
| Ga0210142_10065853 | 3300025552 | Natural And Restored Wetlands | MDRETARRNISSGLLTGGIAAAVFALCFVAAMLYVAS |
| Ga0210110_10026504 | 3300025565 | Natural And Restored Wetlands | VDRETSRRDIRAGLVAGGFAAAVFGLCFVAAMLYIAS |
| Ga0210110_10108555 | 3300025565 | Natural And Restored Wetlands | PGLIEIRLVDRETSRRDMAAGLLAGGIAAAIFALCFVAATLYIAS |
| Ga0210095_10171204 | 3300025568 | Natural And Restored Wetlands | VDRETSKREMAAGLQAGAFAAAVFALCFVAAMFYIAS |
| Ga0207874_10608011 | 3300025571 | Ionic Liquid And High Solid Enriched | VDRETARKNMATGLAAGGFAAAIFALTFVAAILYIA |
| Ga0210085_100059319 | 3300025583 | Natural And Restored Wetlands | MDRELARKNMSTGLVAGGLAVAVFALAFLAAFLYIAVS |
| Ga0210096_11982002 | 3300025593 | Natural And Restored Wetlands | VDRETSRRDISAGLMAGGIAATIFALCFVAATLYIAS |
| Ga0210086_10131822 | 3300025615 | Natural And Restored Wetlands | MDRETARRNVVAGLLTGGIAAAIFALCFVAAMLYIAS |
| Ga0210086_11010453 | 3300025615 | Natural And Restored Wetlands | MDRETARRNMSSGLLTGGIAAAVFALCFVAAMLYVAT |
| Ga0208219_10031387 | 3300025625 | Arctic Peat Soil | MDRETARRNMTTGLMTGGFAAAIFALSFVVAFLYIAQ |
| Ga0208589_11008342 | 3300025634 | Arctic Peat Soil | VDRETARKNMTAGLVAGGLAATVFALCFIVALLYIAH |
| Ga0210100_10002307 | 3300025780 | Natural And Restored Wetlands | MDRESARAKMSAGLVAGGIAAGIFALCFVVAMLYIAS |
| Ga0210100_10002519 | 3300025780 | Natural And Restored Wetlands | MDRETARRNIGAGLMLGGFAAAIFALSFVAAILYIAQ |
| Ga0210063_100005912 | 3300025798 | Natural And Restored Wetlands | VDRETARKNMSSALVAGGFAAAVFALAFVAAFLYIAQA |
| Ga0210122_10090575 | 3300025799 | Natural And Restored Wetlands | VDRESSRQDIRAGLVAGGFAAAVFGLCFVAAMLYIAS |
| Ga0210101_100019611 | 3300025814 | Natural And Restored Wetlands | VDRETSRRDIGAGLTAGAFAAAVFALCFVAAMLYIAS |
| Ga0210101_100033913 | 3300025814 | Natural And Restored Wetlands | MDRETAKRDLTAGLVVGGIAAGVFALCFVTAMLYIAS |
| Ga0210101_11047642 | 3300025814 | Natural And Restored Wetlands | VDRELAKRNMSGGLIVGGLAAAVFALSFVAAMLYIAS |
| Ga0210144_100014827 | 3300025817 | Natural And Restored Wetlands | MDRETARRELTAGLVTGGIAAGVFALCFVAAMLYIAS |
| Ga0210144_100028028 | 3300025817 | Natural And Restored Wetlands | VDRETARRDLTAGLVAGGIAAGVFALCFVTAMLYIAS |
| Ga0210144_11294793 | 3300025817 | Natural And Restored Wetlands | VDRETAKRNVSAGLLAGGIAASIFALTFVAAMLYIAS |
| Ga0210123_10498132 | 3300025823 | Natural And Restored Wetlands | VDRESAQGNIGAGLLAGGIAVGVFALAFVVAVLYIAS |
| Ga0210123_11224262 | 3300025823 | Natural And Restored Wetlands | VDRETSRRDISAGLMAGGIAAAIFALCFVAATLYIAS |
| Ga0209176_100167802 | 3300025854 | Arctic Peat Soil | VDRETSKREMSAGLQAGAFAAAVFALCFVAAMLYIAS |
| Ga0209584_102772282 | 3300025878 | Arctic Peat Soil | VDRETARKNMTAGLVAGGIAAAVFALSFVAAFLYIAQ |
| Ga0207692_101267872 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRETARRNIGSGLMLGGFAAAIFALSFVAALLNIAQ |
| Ga0207642_10000005198 | 3300025899 | Miscanthus Rhizosphere | VDRETARAKMSAGLLAGGIVAAIFALCFVVAMLYVAS |
| Ga0207642_1000073711 | 3300025899 | Miscanthus Rhizosphere | MDRETARRDMAAGLLAGGVAAAVFALCFLAAMLYIAS |
| Ga0207642_100193484 | 3300025899 | Miscanthus Rhizosphere | MDREAARKNMSSGLVAGGLAAAVFALCFVAAFLYIAQ |
| Ga0207685_1000001239 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRETARAKMSAGLLAGGIAAAIFALCFVAATLYVAS |
| Ga0207699_111332202 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRETAKRNMAAGLLAAGIAAVVFALCFVAAFMYIAS |
| Ga0207643_106637341 | 3300025908 | Miscanthus Rhizosphere | TGLSSRNPAMDRETARRNMTGGLVAGGFAAAIFALTFVVALLYIAQ |
| Ga0207654_106504291 | 3300025911 | Corn Rhizosphere | VDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG |
| Ga0207707_100598175 | 3300025912 | Corn Rhizosphere | VDRETARANIGAGLVAGGITAAIFALCFVAAMLYIAS |
| Ga0207707_110954482 | 3300025912 | Corn Rhizosphere | VDRERARSNIAAGLLAGAIAAGVFALAFVVAVLYIAS |
| Ga0207693_1001082511 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRETARRQLKAGLVAGGIAAGVFALSFVAAFLYIAQ |
| Ga0207693_112129942 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRELARRNLSAGLLAGGVAAAVFALCFVAAFIYIAS |
| Ga0207657_101666532 | 3300025919 | Corn Rhizosphere | MDRESARQSMRAGLVAGGIAAGIFALSFVAAFLYIAS |
| Ga0207694_10000012127 | 3300025924 | Corn Rhizosphere | MDRESARANMSAGLVAGGIAAAIFALCFVAAMLYVAS |
| Ga0207694_104965412 | 3300025924 | Corn Rhizosphere | VDRQTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS |
| Ga0207659_1000005535 | 3300025926 | Miscanthus Rhizosphere | MDRETARRQMRAGLIAGGVAAGIFALSFVAAFLYIAQ |
| Ga0207687_100209552 | 3300025927 | Miscanthus Rhizosphere | MDRETARRNMRAGLVAGGIAAGIFALSFAAAFLYIAQ |
| Ga0207700_10000003179 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRESARQSMRAGLVAGGIAAAIFALSFVAAFLYIAS |
| Ga0207664_1001553510 | 3300025929 | Agricultural Soil | MDRESARRNLRAGLLAGGIAAGIFALSFVAAFLYLAQ |
| Ga0207686_103394302 | 3300025934 | Miscanthus Rhizosphere | VDRETARRNMTAGLVAGGFAAAVFALCFVVALLYIAH |
| Ga0207669_101072934 | 3300025937 | Miscanthus Rhizosphere | VDRERSRSNIATGLLAGGIAAGVFALAFVVAVLYIAS |
| Ga0207704_102453472 | 3300025938 | Miscanthus Rhizosphere | VDRETARKNMGAGLVAGGIAAAVFALCFVAAFLYIAQ |
| Ga0207704_112536473 | 3300025938 | Miscanthus Rhizosphere | MDRDSARRQLSAGLLAGGIAAGIFALSFVAAFLYIAA |
| Ga0207665_114374242 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRETARRNMIGGLVAGGFAAAIFALSFVVALLYVAQ |
| Ga0210126_1004642 | 3300025946 | Natural And Restored Wetlands | VDRETARAGISAGLLAGGIAAAVFALSFVAAVLYIAS |
| Ga0207667_106170932 | 3300025949 | Corn Rhizosphere | VDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAH |
| Ga0207667_107003162 | 3300025949 | Corn Rhizosphere | VDRETARANIGAGLVAGGITAGIFALCFVAAMLYIAS |
| Ga0207712_10000027230 | 3300025961 | Switchgrass Rhizosphere | VDRETAKANMVAGLVAGGIAAAIFALCFVAAMLYIAS |
| Ga0207712_110452902 | 3300025961 | Switchgrass Rhizosphere | VDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH |
| Ga0207712_112139842 | 3300025961 | Switchgrass Rhizosphere | VDRETARKNLGAGLVAGGLAAAVFALCFVAAFLYIAQ |
| Ga0207658_101039473 | 3300025986 | Switchgrass Rhizosphere | MDRQTARKNMSSGLVAGGFAAAIFALCFVAAFLYIAQ |
| Ga0207658_104862841 | 3300025986 | Switchgrass Rhizosphere | ARTDRNPAVDRETARRNMTAGLIAGGFSAVVFALCFIVALLYIAHG |
| Ga0207658_105327091 | 3300025986 | Switchgrass Rhizosphere | MDRETARRQMRAGLVTGGIAAGVFALSFVAAFLYIAG |
| Ga0208777_10107612 | 3300025996 | Rice Paddy Soil | VDRESARASVSAGLVAGGIAAAIFALSFVAAVLYIAS |
| Ga0208777_10132663 | 3300025996 | Rice Paddy Soil | VDRETARAKMSAGLLAGGIAAAIFALCFVAAMLYVAS |
| Ga0207677_1000364810 | 3300026023 | Miscanthus Rhizosphere | VDRESARASISASLVAGGIAAAVFALSFVAAVLYIAS |
| Ga0207677_100090014 | 3300026023 | Miscanthus Rhizosphere | MDRETARRQLKAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0208911_10002613 | 3300026051 | Natural And Restored Wetlands | VDRETSRANISAGLLAGGIATAIFALCFVAAMLYIAS |
| Ga0208911_10049162 | 3300026051 | Natural And Restored Wetlands | VDRETSRRDLRAGLLAGGIAAAVFALCFVVATLYIAS |
| Ga0208421_10186762 | 3300026058 | Natural And Restored Wetlands | VDRESARANITAGLVAGGIAVGVFALCFVVAMLYIAS |
| Ga0208290_10000396 | 3300026066 | Natural And Restored Wetlands | VDRESARANISAGLVAGGIAATIFALCFVAAMLYIAS |
| Ga0207678_101187852 | 3300026067 | Corn Rhizosphere | MDRETSRRDMAAGLMAGGIAAAIFALCFVAATLYIAS |
| Ga0207678_103471123 | 3300026067 | Corn Rhizosphere | VDRERARRSIGAGLLAGGIAAGVFALAFVVAVLYIAS |
| Ga0207708_105249473 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRESARKNMSSGLVAGALAASVFALCFVAAFLYIAQ |
| Ga0207641_100760275 | 3300026088 | Switchgrass Rhizosphere | VDRETARKNMTTGLVAGGFAAGVFALCFIAAFLYIASS |
| Ga0207676_10000016289 | 3300026095 | Switchgrass Rhizosphere | VDRETARRDLKAGLLAGGIAAAVFALCFVVATLYIAS |
| Ga0209950_10050583 | 3300026107 | Soil | VDRETSKREMAAGLQAGAFAAAVFALCFVAAMLYIAS |
| Ga0207683_101967421 | 3300026121 | Miscanthus Rhizosphere | VDRETARAKMSAGLLAGGIAAAIFALCFVATMLYVAS |
| Ga0207698_115933502 | 3300026142 | Corn Rhizosphere | MDRETARANIGAGLVAGGIVAAVFALCFVAAMLYIAS |
| Ga0207698_117210771 | 3300026142 | Corn Rhizosphere | LVDRQTAKGNMAAGLVAGGIAAAIFALSFVVAVLYIAS |
| Ga0207698_122656821 | 3300026142 | Corn Rhizosphere | VDRESARASISAGLVAGGVAAAVFALSFVAAVLYVAS |
| Ga0208998_100000831 | 3300027524 | Forest Soil | VDRETARKSISSGLVAGGFAAAVFALCFVVALLYIAQ |
| Ga0214469_10028973 | 3300027636 | Soil | VDRETAKSSISTGMVTGGIAAAIYALCFVAAIFYIAS |
| Ga0214469_11457662 | 3300027636 | Soil | VDRETARRNISGGLLAGAIAAAVFALCFVAAMLYIAS |
| Ga0209178_13582262 | 3300027725 | Agricultural Soil | MDRDSARRQLSAGLVAGGIAAGIFALSFVAAFLYIAA |
| Ga0209074_104474442 | 3300027787 | Agricultural Soil | MDRETARRNMRAGLIAGGIAAGIFALSFVAAFLYIAQ |
| Ga0209382_100235347 | 3300027909 | Populus Rhizosphere | VDRETARRRISAGFVAGAFAASVFALCFVVAVLYIAQ |
| Ga0247662_10649792 | 3300028293 | Soil | MDRETARRNMTGGLVAGGFAAAIFALTFVVALLYIAQ |
| Ga0268266_100155883 | 3300028379 | Switchgrass Rhizosphere | MDRESARRQLSAGLVAGGIAAGIFALSFVAAFLYVAA |
| Ga0268266_111990423 | 3300028379 | Switchgrass Rhizosphere | AVDRETARRNMTAGLVAGGFAATVFALCFIVALLYIAH |
| Ga0268265_124307811 | 3300028380 | Switchgrass Rhizosphere | DRETARRNMRAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0268264_1000119111 | 3300028381 | Switchgrass Rhizosphere | VDRETARAKMNAGLLAGGIAAAIFALCFVAATLYVAS |
| Ga0268264_121379172 | 3300028381 | Switchgrass Rhizosphere | VDRESARASIATGLVAGGVAAAVFALSFVAAVLYIAS |
| Ga0265337_10012566 | 3300028556 | Rhizosphere | VDRETARRNMTAGLVAGGFAAGMFALSFIVALLYIAQ |
| Ga0265337_11995932 | 3300028556 | Rhizosphere | VDRETARKNMTGGLVAGGFAAAIFALAFVAAFLYIAQ |
| Ga0265326_101564832 | 3300028558 | Rhizosphere | VDRETARKNMVGGLVAAGFAAAIFALAFVAAFLYIAQ |
| Ga0307285_1000000427 | 3300028712 | Soil | MDRENARRQMRAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0307309_100561962 | 3300028714 | Soil | MDRESARANMSAGLVAGGLATAVFALCFVAAMLYIAS |
| Ga0307315_100576602 | 3300028721 | Soil | MDRETARRNMRAGLVAAGFAAGIFALSFVAAFLYIAQ |
| Ga0307280_1000002450 | 3300028768 | Soil | MDRESARRQMRAGLVAGGIAAGVFALSFVAAFLYIAQ |
| Ga0307280_102522381 | 3300028768 | Soil | DRESARRNIATGLLAGGIAAGIFALAFVAAVLYIAS |
| Ga0307280_102601032 | 3300028768 | Soil | VDRERARSNIATGLLAGGIAAAVFALAFVAAVLYIAS |
| Ga0307306_100000445 | 3300028782 | Soil | MDRETARRNMSAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0307503_1000013227 | 3300028802 | Soil | VDRETARANMAAGLTAGGIAAAVFALCFVAAMLYIAS |
| Ga0307503_106297342 | 3300028802 | Soil | MDREHAKRSMSAGLLAGAFAAAIFALAFLAAVLYVAS |
| Ga0307289_100356262 | 3300028875 | Soil | VDRETARRNMIGGLVAGGFATAIFALSFVVALLYIAQ |
| Ga0311334_118209461 | 3300029987 | Fen | MDRESARRNLGSGLVIGAIAAGIFALSFIVATLYIASA |
| Ga0299907_102030873 | 3300030006 | Soil | MDRETARRNLGSGLLIGSFAAFVFALSFLTAMLYIAQ |
| Ga0268259_100923952 | 3300030499 | Agave | MDRENARRNMSAGLVAGGLAAAVFALCFVAAFLYIAQ |
| Ga0268243_10068652 | 3300030510 | Soil | VDRETSRRDIRAGLLAGGFAAAVFALCFVAATLYIAS |
| Ga0307499_100052365 | 3300031184 | Soil | VDRETARRDIGAGLLAGGIAAGVFALCFVAAMLYIAS |
| Ga0307497_104891731 | 3300031226 | Soil | VDRETARAKMSAGLLAGGIAAAIFALCFVAATLYIAS |
| Ga0299914_100001918 | 3300031228 | Soil | VDRESARSSVAAGLLAGGVAAGVFALCFVAAMLYIAS |
| Ga0299914_100106435 | 3300031228 | Soil | VDRESTKQNISAGLLAGAFAAAIFALSFIAAMLYIAS |
| Ga0299913_100932942 | 3300031229 | Soil | VDRETSKRSMTTGLLAGGVAAAVFALTFLAATLYIAT |
| Ga0307442_11321322 | 3300031274 | Salt Marsh | MDRETARRELTAGLVAGGIAAAVFALCFVTAVLYIA |
| Ga0307440_10077222 | 3300031367 | Salt Marsh | VDRETSRRDITAGLLAGGIAAAIFALCFVAATLYIAS |
| Ga0307440_11434741 | 3300031367 | Salt Marsh | MDRETARKNMVGGLVAGGFATAIFALAFVAAFLYVAQ |
| Ga0102761_121736121 | 3300031411 | Soil | VDRETARRNMFAGMAAAGFAAVVFALCFIVALLYIAH |
| Ga0307468_1010289471 | 3300031740 | Hardwood Forest Soil | MDRESARRQMSAGLLAGGIAAGIFALSFVAAFLYIAA |
| Ga0315297_103540972 | 3300031873 | Sediment | VDRESAKRNIGGGLAFGAFAAGMFALAFVAAMLYIAP |
| Ga0308175_10000037135 | 3300031938 | Soil | MDRELARKNMRAGLVAGGLATAVFALAFVAAVLYIAQ |
| Ga0308176_104879912 | 3300031996 | Soil | VDRETARRDLTAGLVAGGIAAAIFALCFVAATLYIAS |
| Ga0307416_1030640293 | 3300032002 | Rhizosphere | ELRTMDRETARRSISAGLVAGGIAAGVFALCFVTAFIYIAQ |
| Ga0308173_118524212 | 3300032074 | Soil | MDRETARRQMRAGLVVGGIAAGIFALSFVAAFLYIAQ |
| Ga0326721_1000005125 | 3300032080 | Soil | MDRETARRSIGAGLVAGGIAAGVFALCFVTAFIYIAQ |
| Ga0307415_1006494602 | 3300032126 | Rhizosphere | MDRETARRSISAGLVAGGIAAGVFALCFVTAFIYIAQ |
| Ga0315912_112016592 | 3300032157 | Soil | MDRESARRQLSAGLVAGGIAAGVFALSFVAAFLYIAA |
| Ga0307470_100087813 | 3300032174 | Hardwood Forest Soil | VDRETSRRDIGAGLLAAGIAAGIFAICFVVATLYIAS |
| Ga0307470_110801952 | 3300032174 | Hardwood Forest Soil | MDRESARRQLKAGLVAGGIAAGIFALSFVAAFLYIAQ |
| Ga0307471_1001787765 | 3300032180 | Hardwood Forest Soil | DRNLAVDRETARRKVSAGLVAGGFAAAVFALSFVVALLYIAQ |
| Ga0307472_1011899872 | 3300032205 | Hardwood Forest Soil | MDRESSRAGIKAGLVAGGIAAGIFALSFVAAFLYIAS |
| Ga0307472_1014283652 | 3300032205 | Hardwood Forest Soil | VDRETAKSNMTAGLLAGGVAAAIFALSFVVAVLYIAS |
| Ga0335070_1000009980 | 3300032829 | Soil | VDRETARKNMVGGLVAGGFAAAIFALTFVAAFLYIAAS |
| Ga0335070_101091475 | 3300032829 | Soil | VDRDLARKNMVGALVAGGFAAAIFALCFVAALLYIAQ |
| Ga0335070_101907394 | 3300032829 | Soil | MDRETARRNMAGGLVAAGFATAIFALSFVAAFLYIAQG |
| Ga0335070_102384972 | 3300032829 | Soil | MDRETARANMSAGLLAGGIAAAIFALCFVAAMLYIAS |
| Ga0335075_104667183 | 3300032896 | Soil | VDRETARKNMSAGLVAGGIAAAVFALAFVAAFLYVGAA |
| Ga0335075_112936182 | 3300032896 | Soil | VDRETARRNMTAGLVAGGFAAAVFALSFIVALLYIAH |
| Ga0335083_10000084100 | 3300032954 | Soil | VDRETAHKGMTAGLIAGGFSALVFALCFIVALLYIAH |
| Ga0335083_113366322 | 3300032954 | Soil | MDRELARKNIRAGLIAGGVAAAVFALCFAVAFLYIAS |
| Ga0326726_100280346 | 3300033433 | Peat Soil | MDRETARQRLSAGLLAGGIAAGVFALCFIVATLYIAS |
| Ga0370484_0042838_906_1019 | 3300034125 | Untreated Peat Soil | VDRETARRNMTAGLVAGGLAAAVFALSFIVALLYIAQ |
| Ga0370490_0174418_49_162 | 3300034128 | Untreated Peat Soil | VDRETSRANISAGLLAGGIGAAVFALCFVAAVLYIAS |
| Ga0364925_0018486_2087_2194 | 3300034147 | Sediment | RETARRDIAAGLVAGGIAAGVFALCFVAAVLYIAS |
| Ga0334960_000648_11082_11195 | 3300034402 | Sub-Biocrust Soil | VDRETSKRQISAGLVAGGFAAAVFALCFVAATLYIAS |
| Ga0334905_000287_4010_4123 | 3300034687 | Soil | VDRETSKRQITAGLVAGGFAAAVFALCFVAATLYIAS |
| Ga0364923_0014158_404_517 | 3300034690 | Sediment | VDRETARRDMAAGLVAGGIAAGVFALCFVAAVLYIAS |
| Ga0334935_102643_647_757 | 3300034781 | Biocrust | VDRDTARRNIGSGLLYGGIAAAIFALCFIASILYIA |
| Ga0370497_0055924_631_744 | 3300034965 | Untreated Peat Soil | VDRETARTNMGAGLLAGGIAAAVFALCFVAAMLYIAS |
| ⦗Top⦘ |