NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032932

3300032932: Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300032932 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128851 | Gp0330571 | Ga0314717
Sample NameMetatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size52285050
Sequencing Scaffolds13
Novel Protein Genes14
Associated Families14

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida1
Not Available4
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.3956Long. (o)-85.372Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000459Metagenome / Metatranscriptome1109Y
F001705Metagenome / Metatranscriptome648Y
F007513Metagenome / Metatranscriptome349Y
F014095Metagenome / Metatranscriptome265Y
F020484Metagenome / Metatranscriptome223Y
F029306Metagenome / Metatranscriptome188Y
F033278Metagenome / Metatranscriptome177Y
F042712Metagenome / Metatranscriptome157Y
F061504Metagenome / Metatranscriptome131N
F062345Metagenome / Metatranscriptome130Y
F067310Metagenome / Metatranscriptome125Y
F069562Metagenome / Metatranscriptome123Y
F082073Metagenome / Metatranscriptome113Y
F096516Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314717_107413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1134Open in IMG/M
Ga0314717_108205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1087Open in IMG/M
Ga0314717_116768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida788Open in IMG/M
Ga0314717_118155Not Available758Open in IMG/M
Ga0314717_118635All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum748Open in IMG/M
Ga0314717_119026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae740Open in IMG/M
Ga0314717_120055Not Available720Open in IMG/M
Ga0314717_122958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare672Open in IMG/M
Ga0314717_128616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta596Open in IMG/M
Ga0314717_130339All Organisms → cellular organisms → Eukaryota578Open in IMG/M
Ga0314717_136921Not Available515Open in IMG/M
Ga0314717_137540All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
Ga0314717_138815Not Available501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314717_107413Ga0314717_1074131F007513MVVTVLQRVVDLPVVLLVVLSTDMDHGTKALEEVTMHHAFLAVVVVSLAVDGTGDT
Ga0314717_108205Ga0314717_1082051F061504MENPSLNLSLLCLAPKYLDLILWALSFGLHWRVDVHKHASNHHGLRSFVRALAFVFLRVI
Ga0314717_116768Ga0314717_1167682F069562MGNYLTILPLIALLLLDLLNSNLGPQLCRSNAPKWFGEDVPELSSCLDILEPDLSTIDAITDEVILGVDVLASVVVDGVLC
Ga0314717_118155Ga0314717_1181551F020484MAKTLDAARSEIRNRLQRWDKMDTTLLFGINFVRISTSWKGKFVHFAMEQCFSTGSVLEIERKICEDETAMGQRGIEGGDDDVKQ
Ga0314717_118635Ga0314717_1186352F001705MYVYNELTWDELVKRDFKDWNISKEIALDRSAWRLAINVPES
Ga0314717_119026Ga0314717_1190261F042712MEYLFDESGRQKFLQLLADRPALELVEASQALLHRLGVGSDIKRVLGDLPRYARHVRGAPRKDICVGAEEIDEHHFLF
Ga0314717_120055Ga0314717_1200551F096516MKEDSKSLAQAGMLTEIEDIVNLKILIEEVRLDQDMKAQVLCMSFYVNLSIGCRTIKGGAISVV
Ga0314717_122958Ga0314717_1229581F067310PEDTLDTDLEAMMTRLNEIPNRVQAWKKSAARCGADVALSLVRVHCKDAKEEKLKTLQVANTKKLKFEDFMETFIEAATRIADGIDLDSFVEPASPTGA
Ga0314717_123437Ga0314717_1234371F000459VHSGRIKLAENVKRGRGRPHLTWEESVKRDLKVWDIAKELAMDRGAWKLAIHVPEP
Ga0314717_128616Ga0314717_1286162F033278NDEVKGSSRGFQVSSEISFLISARKTLPTSGQTIDVTFDPKIFTN
Ga0314717_130339Ga0314717_1303392F082073KILAAAKELSLKESMPSKKPSQSSVKLTGDVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0314717_136921Ga0314717_1369211F029306TKLNKSKKNILDTRHENKANKTGFAIFSLSRKKFYIKPYFGQQARNRNKTLTNRKESCEQAAPLKTTPHKESNKI
Ga0314717_137540Ga0314717_1375401F062345GMPKVEWSYLNSIVGTIFGFLCIAVTAFGFLQLLSGVFVVVEESFVLELMAYNSDLRLCTENR
Ga0314717_138815Ga0314717_1388151F014095MLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.