Metagenome / Metatranscriptome Family F033278

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F033278
Family Type	Metagenome / Metatranscriptome
Number of Sequences	177
Average Sequence Length	45 residues
Representative Sequence	SKASKDSSRGFQVSSEISFLISARKTLPTSGQTIDVTFDPKIFTN
Number of Associated Samples	78
Number of Associated Scaffolds	177

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	84.18 %
% of genes from short scaffolds (< 2000 bps)	86.44 %
Associated GOLD sequencing projects	78
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (81.356 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (90.960 % of family members)
Environment Ontology (ENVO)	Unclassified (97.175 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (82.486 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 36.99% β-sheet: 0.00% Coil/Unstructured: 63.01%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 177 Family Scaffolds
PF13474	SnoaL_3	2.26
PF12295	Symplekin_C	1.69
PF00609	DAGK_acc	0.56
PF05699	Dimer_Tnp_hAT	0.56
PF04827	Plant_tran	0.56
PF13966	zf-RVT	0.56
PF02297	COX6B	0.56

COG ID	Name	Functional Category	% Frequency in 177 Family Scaffolds
COG1597	Phosphatidylglycerol kinase, diacylglycerol kinase family	Lipid transport and metabolism [I]	1.13

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
All Organisms	root	All Organisms	18.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
cellular organisms	root	All Organisms → cellular organisms	18.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	18.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	18.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	18.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	18.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	18.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	14.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	14.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	14.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	14.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	12.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	12.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	12.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	12.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	12.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	12.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	10.17 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	10.17 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	8.47 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.69 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	8.47 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.69 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	8.47 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	1.13 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	8.47 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	1.13 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	8.47 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1.13 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.36 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	8.47 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1.13 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.56 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300009992\|Ga0105120_1038119	Not Available	588	Open in IMG/M
3300009995\|Ga0105139_1121320	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	507	Open in IMG/M
3300010397\|Ga0134124_13091946	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	509	Open in IMG/M
3300015273\|Ga0182102_1016549	Not Available	664	Open in IMG/M
3300015278\|Ga0182099_1034660	Not Available	623	Open in IMG/M
3300015278\|Ga0182099_1041982	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	592	Open in IMG/M
3300015278\|Ga0182099_1066934	Not Available	518	Open in IMG/M
3300015284\|Ga0182101_1059120	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	604	Open in IMG/M
3300015284\|Ga0182101_1061639	Not Available	596	Open in IMG/M
3300015284\|Ga0182101_1084482	Not Available	534	Open in IMG/M
3300015293\|Ga0182103_1098267	Not Available	512	Open in IMG/M
3300015297\|Ga0182104_1021631	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	891	Open in IMG/M
3300015297\|Ga0182104_1023957	Not Available	864	Open in IMG/M
3300015309\|Ga0182098_1101299	Not Available	548	Open in IMG/M
3300015309\|Ga0182098_1127643	Not Available	503	Open in IMG/M
3300015310\|Ga0182162_1053220	Not Available	696	Open in IMG/M
3300015311\|Ga0182182_1003490	Not Available	1551	Open in IMG/M
3300015311\|Ga0182182_1025342	Not Available	858	Open in IMG/M
3300015312\|Ga0182168_1019465	Not Available	992	Open in IMG/M
3300015312\|Ga0182168_1051050	Not Available	728	Open in IMG/M
3300015312\|Ga0182168_1128300	Not Available	516	Open in IMG/M
3300015313\|Ga0182164_1112780	Not Available	544	Open in IMG/M
3300015315\|Ga0182120_1030846	Not Available	868	Open in IMG/M
3300015315\|Ga0182120_1060952	Not Available	689	Open in IMG/M
3300015315\|Ga0182120_1075130	Not Available	639	Open in IMG/M
3300015315\|Ga0182120_1132893	Not Available	512	Open in IMG/M
3300015316\|Ga0182121_1088457	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	618	Open in IMG/M
3300015317\|Ga0182136_1014115	Not Available	1100	Open in IMG/M
3300015317\|Ga0182136_1016503	Not Available	1050	Open in IMG/M
3300015317\|Ga0182136_1028856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	885	Open in IMG/M
3300015318\|Ga0182181_1034230	Not Available	761	Open in IMG/M
3300015319\|Ga0182130_1068354	Not Available	649	Open in IMG/M
3300015319\|Ga0182130_1071396	Not Available	640	Open in IMG/M
3300015319\|Ga0182130_1102279	Not Available	563	Open in IMG/M
3300015320\|Ga0182165_1009986	Not Available	1266	Open in IMG/M
3300015320\|Ga0182165_1058605	Not Available	716	Open in IMG/M
3300015320\|Ga0182165_1089351	Not Available	614	Open in IMG/M
3300015320\|Ga0182165_1099661	Not Available	588	Open in IMG/M
3300015320\|Ga0182165_1112762	Not Available	561	Open in IMG/M
3300015320\|Ga0182165_1146659	Not Available	502	Open in IMG/M
3300015324\|Ga0182134_1013669	Not Available	1135	Open in IMG/M
3300015324\|Ga0182134_1083220	Not Available	630	Open in IMG/M
3300015324\|Ga0182134_1098541	Not Available	591	Open in IMG/M
3300015327\|Ga0182114_1010208	Not Available	1310	Open in IMG/M
3300015327\|Ga0182114_1119209	Not Available	573	Open in IMG/M
3300015328\|Ga0182153_1029554	Not Available	904	Open in IMG/M
3300015328\|Ga0182153_1091514	Not Available	615	Open in IMG/M
3300015331\|Ga0182131_1002532	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1830	Open in IMG/M
3300015331\|Ga0182131_1037866	Not Available	853	Open in IMG/M
3300015331\|Ga0182131_1092152	Not Available	621	Open in IMG/M
3300015332\|Ga0182117_1030788	Not Available	976	Open in IMG/M
3300015332\|Ga0182117_1157383	Not Available	520	Open in IMG/M
3300015334\|Ga0182132_1002847	Not Available	1858	Open in IMG/M
3300015334\|Ga0182132_1043281	Not Available	855	Open in IMG/M
3300015334\|Ga0182132_1083037	Not Available	675	Open in IMG/M
3300015334\|Ga0182132_1095144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	640	Open in IMG/M
3300015334\|Ga0182132_1154299	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	523	Open in IMG/M
3300015335\|Ga0182116_1034168	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	965	Open in IMG/M
3300015335\|Ga0182116_1097598	Not Available	654	Open in IMG/M
3300015335\|Ga0182116_1125298	Not Available	589	Open in IMG/M
3300015336\|Ga0182150_1164883	Not Available	504	Open in IMG/M
3300015337\|Ga0182151_1039175	Not Available	864	Open in IMG/M
3300015337\|Ga0182151_1041215	Not Available	849	Open in IMG/M
3300015338\|Ga0182137_1066499	Not Available	759	Open in IMG/M
3300015338\|Ga0182137_1139652	Not Available	561	Open in IMG/M
3300015338\|Ga0182137_1158883	Not Available	529	Open in IMG/M
3300015339\|Ga0182149_1002632	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	1949	Open in IMG/M
3300015339\|Ga0182149_1018913	Not Available	1132	Open in IMG/M
3300015339\|Ga0182149_1166968	Not Available	511	Open in IMG/M
3300015340\|Ga0182133_1031540	Not Available	1012	Open in IMG/M
3300015340\|Ga0182133_1036840	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	961	Open in IMG/M
3300015340\|Ga0182133_1156311	Not Available	551	Open in IMG/M
3300015340\|Ga0182133_1158411	Not Available	548	Open in IMG/M
3300015348\|Ga0182115_1005932	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2402	Open in IMG/M
3300015348\|Ga0182115_1022195	Not Available	1636	Open in IMG/M
3300015348\|Ga0182115_1096365	Not Available	926	Open in IMG/M
3300015348\|Ga0182115_1163189	Not Available	714	Open in IMG/M
3300015348\|Ga0182115_1181771	Not Available	674	Open in IMG/M
3300015348\|Ga0182115_1224349	Not Available	600	Open in IMG/M
3300015349\|Ga0182185_1049543	Not Available	1101	Open in IMG/M
3300015349\|Ga0182185_1125575	Not Available	752	Open in IMG/M
3300015349\|Ga0182185_1244491	Not Available	546	Open in IMG/M
3300015350\|Ga0182163_1019411	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1642	Open in IMG/M
3300015350\|Ga0182163_1034620	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1351	Open in IMG/M
3300015350\|Ga0182163_1075253	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	996	Open in IMG/M
3300015350\|Ga0182163_1211315	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	608	Open in IMG/M
3300015350\|Ga0182163_1257355	Not Available	547	Open in IMG/M
3300015350\|Ga0182163_1290893	Not Available	511	Open in IMG/M
3300015352\|Ga0182169_1015627	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1891	Open in IMG/M
3300015352\|Ga0182169_1067200	Not Available	1109	Open in IMG/M
3300015352\|Ga0182169_1094092	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	954	Open in IMG/M
3300015352\|Ga0182169_1108942	Not Available	891	Open in IMG/M
3300015352\|Ga0182169_1236546	Not Available	595	Open in IMG/M
3300015352\|Ga0182169_1246087	Not Available	581	Open in IMG/M
3300015353\|Ga0182179_1069945	Not Available	1002	Open in IMG/M
3300015353\|Ga0182179_1143006	Not Available	742	Open in IMG/M
3300015353\|Ga0182179_1215590	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	614	Open in IMG/M
3300015354\|Ga0182167_1033290	Not Available	1669	Open in IMG/M
3300015354\|Ga0182167_1087431	Not Available	1129	Open in IMG/M
3300015354\|Ga0182167_1091274	Not Available	1106	Open in IMG/M
3300015354\|Ga0182167_1114585	Not Available	990	Open in IMG/M
3300015354\|Ga0182167_1121506	Not Available	961	Open in IMG/M
3300015354\|Ga0182167_1175733	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	788	Open in IMG/M
3300015354\|Ga0182167_1220363	Not Available	690	Open in IMG/M
3300015354\|Ga0182167_1227713	Not Available	677	Open in IMG/M
3300015354\|Ga0182167_1234768	Not Available	665	Open in IMG/M
3300015354\|Ga0182167_1257527	Not Available	628	Open in IMG/M
3300015354\|Ga0182167_1271027	Not Available	608	Open in IMG/M
3300015354\|Ga0182167_1308427	Not Available	560	Open in IMG/M
3300015354\|Ga0182167_1350325	Not Available	516	Open in IMG/M
3300017412\|Ga0182199_1018511	Not Available	1178	Open in IMG/M
3300017414\|Ga0182195_1017866	Not Available	1234	Open in IMG/M
3300017414\|Ga0182195_1093356	Not Available	709	Open in IMG/M
3300017414\|Ga0182195_1114441	Not Available	657	Open in IMG/M
3300017414\|Ga0182195_1115591	Not Available	654	Open in IMG/M
3300017414\|Ga0182195_1139075	Not Available	609	Open in IMG/M
3300017414\|Ga0182195_1167664	Not Available	564	Open in IMG/M
3300017414\|Ga0182195_1170019	Not Available	561	Open in IMG/M
3300017422\|Ga0182201_1012771	Not Available	1105	Open in IMG/M
3300017435\|Ga0182194_1086327	Not Available	625	Open in IMG/M
3300017439\|Ga0182200_1060620	Not Available	711	Open in IMG/M
3300017447\|Ga0182215_1138847	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	557	Open in IMG/M
3300017693\|Ga0182216_1193089	Not Available	534	Open in IMG/M
3300028053\|Ga0268346_1013345	Not Available	732	Open in IMG/M
3300028056\|Ga0268330_1052342	Not Available	537	Open in IMG/M
3300028064\|Ga0268340_1057949	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	585	Open in IMG/M
3300028142\|Ga0268347_1021745	Not Available	584	Open in IMG/M
3300028152\|Ga0268336_1005059	Not Available	854	Open in IMG/M
3300028152\|Ga0268336_1009854	Not Available	712	Open in IMG/M
3300028253\|Ga0268316_1022309	Not Available	521	Open in IMG/M
3300028465\|Ga0268301_102428	Not Available	665	Open in IMG/M
3300028476\|Ga0268329_1018934	Not Available	577	Open in IMG/M
3300032466\|Ga0214503_1279354	Not Available	515	Open in IMG/M
3300032469\|Ga0214491_1061109	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	909	Open in IMG/M
3300032551\|Ga0321339_1029998	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1190	Open in IMG/M
3300032551\|Ga0321339_1048042	Not Available	969	Open in IMG/M
3300032589\|Ga0214500_1141805	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	685	Open in IMG/M
3300032592\|Ga0214504_1071683	Not Available	678	Open in IMG/M
3300032593\|Ga0321338_1386372	Not Available	500	Open in IMG/M
3300032698\|Ga0214485_1045242	Not Available	844	Open in IMG/M
3300032699\|Ga0214494_1020638	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1206	Open in IMG/M
3300032758\|Ga0314746_1080089	Not Available	758	Open in IMG/M
3300032761\|Ga0314733_1050313	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	798	Open in IMG/M
3300032781\|Ga0314742_1052980	Not Available	713	Open in IMG/M
3300032789\|Ga0314725_1020781	Not Available	804	Open in IMG/M
3300032792\|Ga0314744_1024564	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1150	Open in IMG/M
3300032792\|Ga0314744_1051855	Not Available	802	Open in IMG/M
3300032812\|Ga0314745_1001876	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2926	Open in IMG/M
3300032824\|Ga0314735_1081748	Not Available	604	Open in IMG/M
3300032844\|Ga0314743_1064632	Not Available	855	Open in IMG/M
3300032844\|Ga0314743_1074578	Not Available	790	Open in IMG/M
3300032845\|Ga0314727_1034760	Not Available	701	Open in IMG/M
3300032932\|Ga0314717_128616	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	596	Open in IMG/M
3300033526\|Ga0314761_1117364	Not Available	590	Open in IMG/M
3300033535\|Ga0314759_1029599	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1536	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.44%
Environmental	Environmental	0.56%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	99.44%
Terrestrial	Environmental → Terrestrial	0.56%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	96.05%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.13%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.13%
Unclassified	Host-Associated → Plants → Unclassified	1.13%
Soil	Environmental → Terrestrial → Soil	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	96.05%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.13%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.13%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	1.13%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	96.05%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.13%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	1.13%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	0.56%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	90.96%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	5.08%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.13%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.13%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	1.13%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.56%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028465	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032589	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032592	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032593	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032698	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032699	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032758	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032781	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032789	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032824	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032844	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032845	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032932	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070668_1014647601	3300005347	Switchgrass Rhizosphere	MISHKCYSNPHVLMTRSKASKDSSRGFQVSSEISFLISARKALPTSGQTIDVTFDPKFFTN*
Ga0070667_1021352541	3300005367	Switchgrass Rhizosphere	MISHKCYSNPHVLMMRSKASKDSSRGFQVSSEINFLISVRKTLPTSGQTIDVTLGPKIFTN*
Ga0068864_1020142722	3300005618	Switchgrass Rhizosphere	MISHKCYSNPHVLMTRSKASKDSSRGFQVSSEISFLISARKALPTSGQTIDVTFDPKIFTN*
Ga0068860_1023982722	3300005843	Switchgrass Rhizosphere	MISHKCYSNPYVLMMRSKASKDSSRSFQVSSEINFLISIRKILPTSGQNDDVTSKIFYF*
Ga0105120_10381191	3300009992	Switchgrass Associated	MRSKVSKDSSRGFHVSCEISFLISARKALPTSDQTIDVTFDPKIFTMDVGM
Ga0105139_11213201	3300009995	Switchgrass Associated	SKASKDSSRGFQVSSEISFLISARKTLPTYGQTIDVNFEPKIFTN*
Ga0134124_130919461	3300010397	Terrestrial Soil	MARPKASKDWSRGFQVSSEISFLISARKALPTSGQTIDVTFDPKIFTN*
Ga0182102_10165491	3300015273	Switchgrass Phyllosphere	MRSKVSKDSSRDFQANPEISFLISARKPLPISGQIFDVTFGPKILV
Ga0182099_10346602	3300015278	Switchgrass Phyllosphere	KILKDSFRGFQVSSEISFLISIRKALPTFGQTVDLTSKKFHFGN*
Ga0182099_10419822	3300015278	Switchgrass Phyllosphere	MWSKISKDSSRGFQTSSEISFLISARKTLLISDQTIDMTFE
Ga0182099_10669341	3300015278	Switchgrass Phyllosphere	MMRSKASKDSSRGFQVSSEINFLISVRKTLPTSGQTIDVTLGPKIF
Ga0182099_10750542	3300015278	Switchgrass Phyllosphere	MISYKCYSNPHVLMMRSKTSKDLSRGFQVSSEISFLINVQKTFPTSSQTIDV
Ga0182101_10591201	3300015284	Switchgrass Phyllosphere	MTRSKASKDSSRGFQVSSEISFLISARKALPTSGQTIDVTFD
Ga0182101_10616391	3300015284	Switchgrass Phyllosphere	MMRSNASKDSSRVFQVSSEISFLISARKALPTSGQTIDVTFD
Ga0182101_10844821	3300015284	Switchgrass Phyllosphere	MMRSKPSKDSSRGFQASSEISFLISARKALPISGQTIDMTFEQ
Ga0182103_10982671	3300015293	Switchgrass Phyllosphere	GFQVSSEISFLISVRKTLPTSGQTIDVTFEPKIFTN*
Ga0182104_10216311	3300015297	Switchgrass Phyllosphere	DLSRGFQASSEISFLISARKSLPTSGQTFDVTFAPKIFI*
Ga0182104_10239571	3300015297	Switchgrass Phyllosphere	ASKDSSRSFQVSSEISFLISARKALPTSGQTIDVTFDPKVFTN*
Ga0182098_11012991	3300015309	Switchgrass Phyllosphere	KALKDSFRGFQATFEISFLISARKTLPISGQTIDMIFEIKFFTN*
Ga0182098_11276431	3300015309	Switchgrass Phyllosphere	QVSSEINFLISVRKALPTSGQTIDATLGPKIFTN*
Ga0182162_10532201	3300015310	Switchgrass Phyllosphere	MMRSKASKDSSRGFQLNSEISFLINIRKILPTSDQTFDVILESKIFI
Ga0182182_10034902	3300015311	Switchgrass Phyllosphere	SRGFQVSSEISFLISARKTLPTSGQTIDVTFDPKIFTN*
Ga0182182_10253421	3300015311	Switchgrass Phyllosphere	ASKDSSRGFQASSEISFLISARKVFPTSSQTIDVIFKPKIFTN*
Ga0182168_10194651	3300015312	Switchgrass Phyllosphere	GFQASSEISFLISAQKSPPTFGQTFDVTFVPKIFIN*
Ga0182168_10510501	3300015312	Switchgrass Phyllosphere	SRGFQVSSEINFLISIRKALPTSDQTIDVTLGSKIFTN*
Ga0182168_11283001	3300015312	Switchgrass Phyllosphere	MRSKVSKDLSRGFQASSEISFLISARKTFPTSDQTIDVSF
Ga0182164_11127801	3300015313	Switchgrass Phyllosphere	MRSKPSKDSSRGFQASSEISFLISARKALPISGQTIDMTFEPKIF
Ga0182120_10063671	3300015315	Switchgrass Phyllosphere	MISHKYYSNSHVLMMRSKASKDSSRGFQVSSEINFLISVRKILPTSGQSADVARKIFCVSN*
Ga0182120_10308461	3300015315	Switchgrass Phyllosphere	VLMLRSKASKDSSRGFQVSSGISFLISIRKTLPTSGQTFDVILEPKIFIN*
Ga0182120_10609521	3300015315	Switchgrass Phyllosphere	HVLMTRSNASKDSSRDFQVSSEISFLISARKILPTSGQTIDVTFDPKIFTN*
Ga0182120_10751301	3300015315	Switchgrass Phyllosphere	HVLMTRSKASKDSSRGFQVSSEISFLISARKTFPTSGQTINVTFDPKFFTN*
Ga0182120_11328931	3300015315	Switchgrass Phyllosphere	GFQVSSEISFLISIRKALPTSGQTVDVTPKFFLFGN*
Ga0182121_10884571	3300015316	Switchgrass Phyllosphere	SKDSSRGFQVSFEINFLISVRKILSTSGQTIDVTPKFFLFGN*
Ga0182136_10141151	3300015317	Switchgrass Phyllosphere	HVLMMRSKASKDSSRGFQTNSEITFLINAQKILPMSGQTVDVIFELKIFTN*
Ga0182136_10165031	3300015317	Switchgrass Phyllosphere	TNDVAKGLKNLSRGFQTSSEISFLINSRKSLPTSGQIFDVTFVPKIFIN*
Ga0182136_10288561	3300015317	Switchgrass Phyllosphere	GFQASSEINFLISARKTIPTSNQTIDVTIEKKNFTN*
Ga0182181_10342302	3300015318	Switchgrass Phyllosphere	MMRSKISKDSSRGFQANSEISFLISSRKSLPTSNQIFDVTFV
Ga0182130_10683541	3300015319	Switchgrass Phyllosphere	TSKDSSRGFQVSSEISFSISDRKALPTSDQTIDVTFDPKIFTN*
Ga0182130_10713961	3300015319	Switchgrass Phyllosphere	ASKDSSRDFQVSSEISFLICAKKTLPTSNQIIDVTFKPKIFTN*
Ga0182130_11022791	3300015319	Switchgrass Phyllosphere	MIRSKASKDSSRGFQASSEINFLISVQKAFPISGQIIDGTF
Ga0182165_10099862	3300015320	Switchgrass Phyllosphere	GFQMSSEINFLISVRKTLRTSSQIIDVTFEPKIFTN*
Ga0182165_10586051	3300015320	Switchgrass Phyllosphere	KPHVRMMRSNASKDSSRGFQASSEINFLISAQKSLSTSGQIFDVTFVLKIFIN*
Ga0182165_10893512	3300015320	Switchgrass Phyllosphere	MRSKASKDSSRGFQTNSEITFLINAQKILPMSGQTVDVIFELKIFTN*
Ga0182165_10996612	3300015320	Switchgrass Phyllosphere	FQVSSEISFLISVRKTLPTSGQTIDVTFEPKIFTN*
Ga0182165_11127621	3300015320	Switchgrass Phyllosphere	SKDSSRGFQVSSEINFLISVRKTLPTSDQTIDVTLGPKIFTN*
Ga0182165_11466591	3300015320	Switchgrass Phyllosphere	VLMMHSKASKDSSRGFQVSSEISFLISVRETLPTSSQTIDVTSKIFLF*
Ga0182134_10136691	3300015324	Switchgrass Phyllosphere	KGSSRGFQVDFEISFLISAQKFLPISDQTFDVTLGPKILTN*
Ga0182134_10832201	3300015324	Switchgrass Phyllosphere	QASSEISFLISTRKALPTSDQTIDVTFESKIFAN*
Ga0182134_10985411	3300015324	Switchgrass Phyllosphere	TSKDSSRGFQVSSEIGFLISVRKTLPTFNQTVDLT*
Ga0182114_10102081	3300015327	Switchgrass Phyllosphere	DSSRGFQTSSEISFLISAQKSLPTSGQTFNVTFIKKKFIN*
Ga0182114_10963791	3300015327	Switchgrass Phyllosphere	MISHKCYSNPHVLLTRSKASKDSSRGFQVSSEISFLISARKALPTSGQTIDVTFEPKI
Ga0182114_11192091	3300015327	Switchgrass Phyllosphere	NSYVLMMRSKALKDSSRGFQVSSETSILISVRKTLPTSGQTIDLTTKIFLFGN*
Ga0182153_10295541	3300015328	Switchgrass Phyllosphere	FQASSEISFLISARKSLPTSGQAFDVTFVPKIFIN*
Ga0182153_10915141	3300015328	Switchgrass Phyllosphere	SRGFQVSSEINFLISVRKALPTSDQIFDVTFEPKIFIK*
Ga0182131_10025324	3300015331	Switchgrass Phyllosphere	LMMQSNASKDSSRGFQVSSEINFLISVRKALSTSGQIIDVTLGPKIFTN*
Ga0182131_10378661	3300015331	Switchgrass Phyllosphere	MTRSKASKDSSRGFQVRSEISFSISDRKTLPTSDQTIDVTFIPKIFANLTPPELL
Ga0182131_10921521	3300015331	Switchgrass Phyllosphere	MMRSKVSKDLSRGFQASSEISFLISARKSLPASSQTFNVTFVLKIF
Ga0182117_10307881	3300015332	Switchgrass Phyllosphere	MTQSKASKDSSRGFQVSSEISFSISARKALPTSGQIIDVIFDPKIFTN*
Ga0182117_11573831	3300015332	Switchgrass Phyllosphere	GFQVSSEIIFLISVRKVLLTSGQTIDMSPKFFLFGN*
Ga0182147_10610821	3300015333	Switchgrass Phyllosphere	MISHKCYSNLHVLMTRSKASKDSSRGFQVSSEISFLISARKALSTSGQTIDVTFESKIFT
Ga0182132_10028471	3300015334	Switchgrass Phyllosphere	KDSSRGFQMSSKINFLISVRKTLPTSGQTVDVTQKKIWFGN*
Ga0182132_10432811	3300015334	Switchgrass Phyllosphere	KTSKDSSRGFQASSEISFLISAQKSPPTFGQTFDVTFVPKIFIN*
Ga0182132_10830371	3300015334	Switchgrass Phyllosphere	SFQASSEISLLISARKSLPTSGQTFDVTFVPKIFIN*
Ga0182132_10951441	3300015334	Switchgrass Phyllosphere	GFQVSSEISFLINARKTLPTFDQTIDVTFKPKIFTN*
Ga0182132_11542991	3300015334	Switchgrass Phyllosphere	LMMRSKASKDLSRGFQASSEISFLISAKALPTSGQTIDVTFEPKFFH
Ga0182116_10341682	3300015335	Switchgrass Phyllosphere	MMRSKSSKDSSRGFQVSSEINFLISVRKALPTSGQTIDVTLGPKIFT
Ga0182116_10975981	3300015335	Switchgrass Phyllosphere	KASKDSSRGFQVSSEISFLISIRKTLPASGQIFDVIIEPKILIN*
Ga0182116_11252981	3300015335	Switchgrass Phyllosphere	SKASKDSSRGFQASSEISFLISTRKALPTSDQTIDVTFEQKIFAN*
Ga0182150_10902301	3300015336	Switchgrass Phyllosphere	ISHKYYSNPHVLMMRSKASKDSSRGFQVSSEISFLISVRKVLPTSDQTIDVT*
Ga0182150_11648831	3300015336	Switchgrass Phyllosphere	SNASKDSSRGFQASSEISFLISVRKSLPTSGQTFDVIFVPKIFI*
Ga0182151_10391751	3300015337	Switchgrass Phyllosphere	QSKASKDSSRGFQVSSEISFSISARKALPTFGQIIDVTFDPKIFTN*
Ga0182151_10412151	3300015337	Switchgrass Phyllosphere	MRSKASKDSSRGFQVSSEISFLISVREVLPTSGQTIDVTSKIFLF*
Ga0182137_10504461	3300015338	Switchgrass Phyllosphere	MISHKCYSNPHVLMMRPKTSKDLSRGFQVSSEISFLISVRKILPTSDQTVDVTHIFF
Ga0182137_10664991	3300015338	Switchgrass Phyllosphere	SKASKDSSRGFQVSSEISFLISARKALSTSGQTIDVTFDPKIFTN*
Ga0182137_11396521	3300015338	Switchgrass Phyllosphere	SSEISFLISVRKAFPTSSQTVDETVDVTPKKFWLGN*
Ga0182137_11588831	3300015338	Switchgrass Phyllosphere	MMRLKASENSSRSFQASSEISFLISARKALPASGQTIDVTFEPKIFTN*
Ga0182149_10026321	3300015339	Switchgrass Phyllosphere	ASKDSSRGFQMSSEINFLISVRKALPTSGQTIDVTFGPKIFTN*
Ga0182149_10189131	3300015339	Switchgrass Phyllosphere	MMRSKVSKDLSRGFQASSEISFLISARKSLPTSSQTFNVTF
Ga0182149_10897461	3300015339	Switchgrass Phyllosphere	KCYSNPHVLMMRSNASKDSSRGFQVSSEISFLISAPKALPISGQTIDVTFELKIFTN*
Ga0182149_11669681	3300015339	Switchgrass Phyllosphere	FQVSSEISFLISARKALPTSGQIIDVTFEPKIFTN*
Ga0182133_10315401	3300015340	Switchgrass Phyllosphere	VLMTRSKASKDSSRGFQMSSEISFVISIRKTLSTSGQTVDVTSKIFLFGN*
Ga0182133_10368401	3300015340	Switchgrass Phyllosphere	MMQSKASKDLFRGFQASFEISFLISARKILSTSGQTIDAIFEQKIFTN*
Ga0182133_11563111	3300015340	Switchgrass Phyllosphere	DSSRGFQVSSEVNFLISVRKALPTSGQTIDVTLGPKIFTN*
Ga0182133_11584111	3300015340	Switchgrass Phyllosphere	GFQVSSEISFLISVRKTLPISGQSADVTRKFFCVSN*
Ga0182115_10059321	3300015348	Switchgrass Phyllosphere	KASKDSSRDFQASSKISFLISVRKAFPIFSQIIDMTFELKIFTN*
Ga0182115_10221952	3300015348	Switchgrass Phyllosphere	ANDAVKASKDSSRDFQASFEINFLISVRKSLSTSGQIFDVTFVPKIFIN*
Ga0182115_10963651	3300015348	Switchgrass Phyllosphere	DLSRGFHMSSKISFLISVKILPTSDQTVDLTSKKFHFEN
Ga0182115_11202011	3300015348	Switchgrass Phyllosphere	LTISATVPPHVLMMRPKASKNSSRDFQANSEISFLISTRKTLPTSSQTIDVTFDPKNFTN
Ga0182115_11631891	3300015348	Switchgrass Phyllosphere	KDSSRGFQVSSEISFLISIRKVLPTFGQTVDLTSKKISF*
Ga0182115_11817711	3300015348	Switchgrass Phyllosphere	YNNPHVLMMQSKFSKDLSRGFQASSEISFLISVRKSLQTSGQIFNVTFVPKIFIN*
Ga0182115_12243491	3300015348	Switchgrass Phyllosphere	QVSSEISFLISARKALPTSGQTIDVTFEPKIFTN*
Ga0182185_10495431	3300015349	Switchgrass Phyllosphere	SKASKDSSRGFQTNSEISFLISVQKFLPIFNQIFDVTSKNFYFTN*
Ga0182185_11255751	3300015349	Switchgrass Phyllosphere	NPHVLMTRSKASKDSSRGFQVSSEISFLINARKALPISDQTIDVTFE*
Ga0182185_12444911	3300015349	Switchgrass Phyllosphere	KDSSRGFQVSFEISFLISIRKALPTFDQTVDLTSKKIHFGN*
Ga0182163_10194111	3300015350	Switchgrass Phyllosphere	DSSRGFQVSSEISFLISARKTLPTSGQTIDVTFDPKIFTN*
Ga0182163_10346201	3300015350	Switchgrass Phyllosphere	NLYMLMMGSNASKDSSRGFQVSSKINFLISVRKILPTSSQIFNVILEPNFFVN*
Ga0182163_10752531	3300015350	Switchgrass Phyllosphere	NASKDSSRGFQVSSEISFLISVRKTLSTSGQTIDMTFNLKIFTN*
Ga0182163_12113151	3300015350	Switchgrass Phyllosphere	PHVLMMRSKTSKDSSRDFQASSEISFLISVRKTIPTFGQTIDVTFKLKIFTN*
Ga0182163_12417951	3300015350	Switchgrass Phyllosphere	MISHKYYSNPYVLMMRSKSSKDSSRSFQVSSEISFLISIRKTLPTFGQTVDLTSKNFYFG
Ga0182163_12573551	3300015350	Switchgrass Phyllosphere	TRSKASKDSSRGFQVSSEISFLISARKTLPTSGQTIDVTFEPKIFTN*
Ga0182163_12585881	3300015350	Switchgrass Phyllosphere	MISYKCYINPLVLMMRSKASKDSSRGFQVSSEISFLISVRKILLTSDQIIDMTPQNFFLGNGDMDSL*
Ga0182163_12908931	3300015350	Switchgrass Phyllosphere	VLMMRSKVSKDSSRDFQVSFEISFLICARKTFPASGQTIDVIFEPKIFTN*
Ga0182169_10156273	3300015352	Switchgrass Phyllosphere	FQASSEISFLISARKSLPTSDQTFDVTFVPKIFI*
Ga0182169_10375251	3300015352	Switchgrass Phyllosphere	MISYKCYSNPHVLMMRSKASKDSSRGFQTSSEISFLISARKSLPTSSQIFDVTFVLKIFNNYTPL
Ga0182169_10672001	3300015352	Switchgrass Phyllosphere	KCYSNPHVLMMRSNASKDSSRGFQVSSEISFLISVRKTLPTSGQTIDVTS*
Ga0182169_10940922	3300015352	Switchgrass Phyllosphere	MTRSKASKDSSRGFQVSSEISFLISA*KALPTSGQTIDVT
Ga0182169_11089423	3300015352	Switchgrass Phyllosphere	RSKASKDSSRGFQVSSEINFLISAQKTLPTSGQTIDVTFDSKIFTD*
Ga0182169_12365461	3300015352	Switchgrass Phyllosphere	SKDSSRGFQASSEISFLISARKSLPTSGQTFDVTLEPKIFIN*
Ga0182169_12460871	3300015352	Switchgrass Phyllosphere	FQASSEISFLISARKSLPTSGQTFDVTFVPKILVN*
Ga0182169_13073061	3300015352	Switchgrass Phyllosphere	MISHKCYSNPHVLMMRSKASKDLSRGFQTSSEISFLISARKYLPTSGQTFDMTFGPKFLAN*
Ga0182179_10699451	3300015353	Switchgrass Phyllosphere	RSKASKDSSRGFQVSSEISFLISARKALPTSGQSADVTSKNFWGRN*
Ga0182179_11430061	3300015353	Switchgrass Phyllosphere	TRSNASKDSSRGFQVSSKISFLISARKALPTSGQTIDVTFEPKNFTN*
Ga0182179_12155901	3300015353	Switchgrass Phyllosphere	MMRSKASKDLSRGFQASSEINFLISAKTLPTFGQTIDVTFEPKIFTN
Ga0182167_10332901	3300015354	Switchgrass Phyllosphere	VKASKDSSRDFQTSSEISFLISVRKSLSTSGQIFDVTFVPKIFIN*
Ga0182167_10874312	3300015354	Switchgrass Phyllosphere	LMMRSKASKDSSRGFQMSSEISFLISARKVLPTSGQTIDVTFDLKIFTN*
Ga0182167_10912742	3300015354	Switchgrass Phyllosphere	QVSSEISFLISARKTLPTSGQTIDVTFDSKIFTD*
Ga0182167_11145851	3300015354	Switchgrass Phyllosphere	NASKDSSRGFQVSSEISFLISIRKTLPPSGQTFDVILEPKIFIN*
Ga0182167_11215062	3300015354	Switchgrass Phyllosphere	LMMRSKASKDSSRGLQVSSEISFLISARKTLSTSSQTIDMTFEPKIFTT*
Ga0182167_11757331	3300015354	Switchgrass Phyllosphere	DSSRGFQVSSEISFLISARKALPTSGQTIDVTFDPKIFTN*
Ga0182167_12203631	3300015354	Switchgrass Phyllosphere	FQASSEISFLISARKSLPTSGQTFDVTFVPKIFIN*
Ga0182167_12277131	3300015354	Switchgrass Phyllosphere	YSNPHVLMTRSKASKDSSRGFQVSSEINFLISAQKTLPTSSQTIDVTFEPKIFTN*
Ga0182167_12347681	3300015354	Switchgrass Phyllosphere	DSSRSFQMSSEISFLISVRKALPISDQTVDVIPKKFLFGN*
Ga0182167_12575271	3300015354	Switchgrass Phyllosphere	SKASKDSSRDFQVSSEINFLISIRKVLPTSSQTIDVTFDPNIFTN*
Ga0182167_12710271	3300015354	Switchgrass Phyllosphere	SKASKDLSRGFQVSSEISFLISARKTLPISDQTIDVTFDPKIFTN*
Ga0182167_13084272	3300015354	Switchgrass Phyllosphere	SRGFQMSSEISFLISVRKILSTSGQIVDLIIKYFWFGN*
Ga0182167_13503251	3300015354	Switchgrass Phyllosphere	MRPKGLKDSFRGFQATFEISFLINARKTLPISGQTI
Ga0182199_10185111	3300017412	Switchgrass Phyllosphere	MMWSKVSKDSSRGFQGSFEISFLISARKTLPTSGQTIDVIFEPKIFTN
Ga0182195_10178661	3300017414	Switchgrass Phyllosphere	SFQPNFEISFLISARKLLPTSGQTFNVTFVPKIFIN
Ga0182195_10933561	3300017414	Switchgrass Phyllosphere	FQASSEISFLISTRKTLPTSSQTIDVTFESKIFTN
Ga0182195_11144412	3300017414	Switchgrass Phyllosphere	SKTSKDSSRGFQASSEISFLISAQKSPPTFGQTFDVTFVPKIFIN
Ga0182195_11155911	3300017414	Switchgrass Phyllosphere	MMRSNASKDSSRGFQASSEISFLISAQKSLSTSGQIFDVTFVLKIFIN
Ga0182195_11390751	3300017414	Switchgrass Phyllosphere	GFQVSSEISFLISVRKIIPTSGQTVDLTTKFFLFGN
Ga0182195_11676641	3300017414	Switchgrass Phyllosphere	MRSNASKDSSRGFEASSEISFLISDRKTLPTSSQTINVTFE
Ga0182195_11700191	3300017414	Switchgrass Phyllosphere	MTRSKTSKDSSRGFQVSSEISFLISARKALPTSGQTIDVTFDPKIFTN
Ga0182201_10127711	3300017422	Switchgrass Phyllosphere	MMRSNASKDSSRGFQTSFEISFLISVRKALPTSGQTIDETFEQKNFT
Ga0182194_10023701	3300017435	Switchgrass Phyllosphere	MINHKWYSNPHVLMMRSKASKDSSHDFQTSSEINFLISVRKTLPTSSQTIDVTFEKKFTN
Ga0182194_10863272	3300017435	Switchgrass Phyllosphere	SSRGFQVSSEISFLISVRKILSTSRQTIDVTFEPKIFTN
Ga0182194_11030301	3300017435	Switchgrass Phyllosphere	MMQSKASKDSSRGFQVSFEISFLISIRKIIPTSSQTVNLTTKIFGLGTKRALMQIK
Ga0182200_10606201	3300017439	Switchgrass Phyllosphere	MMRSKALKDSSRSFQASSEISFLISAQKSLPTSGQTFDVTFVQKIFIYTDGISGSDP
Ga0182200_11351411	3300017439	Switchgrass Phyllosphere	MISHKYYSNLRVLMMRSKVSKNSSPGFQASSEITFLINARKAFPTSGQTVEVIFKLKIF
Ga0182215_11388471	3300017447	Switchgrass Phyllosphere	SKDSSRGFQVSSEISFLISARKALPISDQTIDVTFDPKIFTN
Ga0182216_11930891	3300017693	Switchgrass Phyllosphere	SKDSSRGFQVSSEISFLISARKAIPTSGQTIDVTFDPKIFTN
Ga0268346_10133451	3300028053	Phyllosphere	ASKNSSRGFQTSSEISFLISAENLSGQTFDVTFLPKIFVN
Ga0268330_10523421	3300028056	Phyllosphere	KDSSRGFQVSSEISFLISIRKALPTSGQTIDVTFDPKIFTN
Ga0268340_10579491	3300028064	Phyllosphere	VSKASKDSSRGFQASSEISFLISTRKTLPTSDQTIDVTFE
Ga0268347_10217451	3300028142	Phyllosphere	SFQASSEISFLISARKSFPTSGQIFDVTFVPKIFIN
Ga0268336_10050591	3300028152	Phyllosphere	SKDSSRGFQVSSEISFLISTRKTLPTSGQTIDVTFDPKIFTKRVFS
Ga0268336_10098541	3300028152	Phyllosphere	SKDSSRGFQVSSEISFLISTRKTLPTSGQTIDLTFDPKIFTN
Ga0268316_10223091	3300028253	Phyllosphere	GFQVSSEISFLISVRKTLPTSGQTIDVTSKIFCVWN
Ga0268301_1024281	3300028465	Phyllosphere	DSSRSFQASSEISFLISVRKSLPTSGQIFDVTFIPKIFIN
Ga0268329_10189341	3300028476	Phyllosphere	SRGFQVNSEISFLISAXKTIPTSGQTIDVTFDPKIFTN
Ga0214503_12200582	3300032466	Switchgrass Phyllosphere	ISHKCYNNPFVLMMRSMVSKDLSRGFQVSYEISFLISVRKALPTSGQTVDVTPKIFLFGN
Ga0214503_12793542	3300032466	Switchgrass Phyllosphere	SKASKDSSRGFQVSSEISFLISARKTLPTSGQTIDVTFDPKIFTN
Ga0214491_10611092	3300032469	Switchgrass Phyllosphere	SKASKDSPRDFQASSEISFLISARKSLPTSGQTFGQTFDVAFVPKIFI
Ga0321339_10299981	3300032551	Switchgrass Phyllosphere	VLMMQSKASKDSSRSFQASSEISYLISARKTLPTSGQTIDVTFEPKIFTN
Ga0321339_10480421	3300032551	Switchgrass Phyllosphere	QMPQRDSPRGFQASSEISFLISARKSLPTFGQTFDVTFVPKIFIN
Ga0214500_11418052	3300032589	Switchgrass Phyllosphere	APKDSSRGFQSSFEISFLISARKSLPTSGQTFDVTFVPKIFI
Ga0214504_10716831	3300032592	Switchgrass Phyllosphere	GFQVSSEISFLISVRKALPTSGQTVDLTSKNFHFGN
Ga0321338_13863721	3300032593	Switchgrass Phyllosphere	QKDSSRGFQVSSEISFLISIRKTLPTSGQTVDMTPKFFLFGN
Ga0214485_10452422	3300032698	Switchgrass Phyllosphere	SKNLSRGFQVSSEISFLISVRKALPTSGQTVDVTPKIFLFGN
Ga0214485_10545542	3300032698	Switchgrass Phyllosphere	CMISHKYYSNPYVLMIRSKASKDSSRGFQASSEISFLIGARKFLPTSDQTFNVTFGPKIFTNYALT
Ga0214494_10206381	3300032699	Switchgrass Phyllosphere	YSNPHVLMMXSKASKDSSHVFQASYEISFLISARKILSTSGQTIDVTFEPKIFTN
Ga0314746_10800893	3300032758	Switchgrass Phyllosphere	GFQVSSEISFLISVRKALPTSGQTVDVTPKFFLFGN
Ga0314733_10503132	3300032761	Switchgrass Phyllosphere	FQASSEISFLINVQKSLPTFGQTFNTAVGPKFFTD
Ga0314742_10529801	3300032781	Switchgrass Phyllosphere	KDSSRGFQVSSEISFLISVRKALPTSGQTVDVTPKIFLFGN
Ga0314725_10207811	3300032789	Switchgrass Phyllosphere	MIRSNTSKYSPRGFQASSEISFLISARKSLPTSDQTFDVTF
Ga0314744_10245641	3300032792	Switchgrass Phyllosphere	KDSSRSFQASSEISFLISARKALPTSGQTIDVTFEQKIFTN
Ga0314744_10518551	3300032792	Switchgrass Phyllosphere	RGFQVSSEISFLISVRKALPTSGQTVDVTPKIFLFGN
Ga0314745_10018761	3300032812	Switchgrass Phyllosphere	ASKDSSRGFQVSSEISFLISARKTLIQTIDVTFESKNFTN
Ga0314735_10817483	3300032824	Switchgrass Phyllosphere	RGFQVSSEISFLISVRKAHPTSGQTLTVTPKIFTQSN
Ga0314743_10646321	3300032844	Switchgrass Phyllosphere	PHVLMMRSNASKDSSRGFQASSEISFLISARKTLIQTIDVTFESKNFTN
Ga0314743_10745781	3300032844	Switchgrass Phyllosphere	DSSRGFQVSSEISFLISVRKALPTSGQTVDVTPKIFLFGN
Ga0314727_10347601	3300032845	Switchgrass Phyllosphere	SSRGFQVSSEISFLISVRKTIPTSGQTIDVTFDPKIFSN
Ga0314717_1286162	3300032932	Switchgrass Phyllosphere	NDEVKGSSRGFQVSSEISFLISARKTLPTSGQTIDVTFDPKIFTN
Ga0314761_11173641	3300033526	Switchgrass Phyllosphere	ASKNLSRGFQVSSEISFLISVRKALPTSGQTVDVTPKIFLFGN
Ga0314757_11668651	3300033534	Switchgrass Phyllosphere	RDESFKPNYCMISHKCYSNPHVLMTRSKASKDSSRGFQVSSEISFLISTRKALPISGQTIDVTFDPKNFTN
Ga0314759_10295991	3300033535	Switchgrass Phyllosphere	VTPHVLMMPSKTSKDSSRGFQASFEISFLISARKALPTSDQTIDATFEPKIFAN

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F033278

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences