NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032811

3300032811: Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300032811 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128851 | Gp0330572 | Ga0314718
Sample NameMetatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size62735778
Sequencing Scaffolds20
Novel Protein Genes22
Associated Families22

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum4
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1
Not Available8
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.3941Long. (o)-85.3741Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000412Metagenome / Metatranscriptome1169Y
F000459Metagenome / Metatranscriptome1109Y
F004317Metagenome / Metatranscriptome443Y
F007513Metagenome / Metatranscriptome349Y
F018668Metagenome / Metatranscriptome233Y
F019078Metagenome / Metatranscriptome231Y
F022580Metagenome / Metatranscriptome213Y
F025200Metagenome / Metatranscriptome202Y
F026180Metagenome / Metatranscriptome198Y
F026477Metagenome / Metatranscriptome197Y
F030332Metagenome / Metatranscriptome185Y
F032517Metagenome / Metatranscriptome179Y
F032552Metagenome / Metatranscriptome179Y
F040424Metagenome / Metatranscriptome161Y
F042140Metagenome / Metatranscriptome158Y
F042712Metagenome / Metatranscriptome157Y
F059695Metagenome / Metatranscriptome133N
F065367Metagenome / Metatranscriptome127N
F067332Metagenome / Metatranscriptome125N
F076802Metagenome / Metatranscriptome117N
F094790Metagenome / Metatranscriptome105Y
F102251Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314718_1000192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae3412Open in IMG/M
Ga0314718_1003624All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1607Open in IMG/M
Ga0314718_1008665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1189Open in IMG/M
Ga0314718_1020457Not Available804Open in IMG/M
Ga0314718_1021353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays786Open in IMG/M
Ga0314718_1021684Not Available779Open in IMG/M
Ga0314718_1023132Not Available753Open in IMG/M
Ga0314718_1024289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum734Open in IMG/M
Ga0314718_1029900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum653Open in IMG/M
Ga0314718_1029915Not Available653Open in IMG/M
Ga0314718_1031385Not Available635Open in IMG/M
Ga0314718_1035304All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum593Open in IMG/M
Ga0314718_1036634All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum581Open in IMG/M
Ga0314718_1037090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii577Open in IMG/M
Ga0314718_1037510All Organisms → cellular organisms → Eukaryota573Open in IMG/M
Ga0314718_1038631Not Available563Open in IMG/M
Ga0314718_1039609All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha555Open in IMG/M
Ga0314718_1040821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum545Open in IMG/M
Ga0314718_1042524Not Available532Open in IMG/M
Ga0314718_1044990Not Available514Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314718_1000192Ga0314718_10001921F032552VISCSKIGQKPAKTKYLQNICANAKTTNNWTDVRMVSDFDIKFMPLSKLNRG
Ga0314718_1003624Ga0314718_10036241F032517MNLSISYSSFDKIINPYSEFLGLYGGGADDLVEHCGGGGIPSVNLIEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCPHTKTNTPGVSCRRENNISKSGAN
Ga0314718_1008665Ga0314718_10086651F022580MACSGSWPHIDYLVPDDNGIIEAAIPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDLALREEMIALLKEYRDYF
Ga0314718_1020457Ga0314718_10204571F004317GALRPCLSPYMDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0314718_1021353Ga0314718_10213531F026180VHPTARHSAADCREIQKLAKRVSGRRDQSSKDSSPPPRQRPGKEKASDSGAADGEKELGYQSPARELKGVYSHDNSDSDNEERRKKLYVMYGGSWELVSQRDVKTLRREVLSVRPGVPKAAPHQRWMNTTISFEP
Ga0314718_1021684Ga0314718_10216841F059695VLARLKGPFDVVPQLVYSKTIAKSDKKPSRHFIRSEAFVNEKVIYRKGPSNRANKVLEVGLWVSYTFGLKQKF
Ga0314718_1023132Ga0314718_10231321F067332MPPSIHVYCHIIILANFGEDEIRRACIIMPSCVVFWVVFLVHSILTRSLRAYIAVLKFCAALLSIQLLAIQIIFLEKLDYEKDMRNYRFTYYRNFNDLRGMFIWISRLNLALDPVPSMLIVTTQ
Ga0314718_1024289Ga0314718_10242891F025200LRPLHIDDDVLGHPNGAVPTSFLLPNLVSNHLAIYFLLDHIGGAIALVPPVGFGVDERTLDCKLLLVLLIRKLLPWLRALVGLVAFFVAL
Ga0314718_1029900Ga0314718_10299001F019078MGDGEKTCPCCQFYGIPCRQVRATEDEATTRRNQRLFSSTKRKRSHQEQLAEDSLFLDSPSVDELQTIQKRKDPECSRDTQVKDQALYDYVDGLTITMKVIQPQSHKDSKEQATEIMQDVMLSSQGGQPSSAFHRRRLCY
Ga0314718_1029915Ga0314718_10299152F042712MEYLLDEFGHHKFLQLLANRPTLELVEASQALLHRLGVGSDIKGVLGDLPRYARHVRGAPREDVCVGAEKVDEHHFLFAVEGGADLQRLVVGAIRV
Ga0314718_1031385Ga0314718_10313851F000412RXNXGNFAQTCSTCLEGPNRKDSSGAHPCRAIDRAXEPRIPSLCSLKAITHATGSKIRSSRSRXNRGTEYYRVGMKTHIEYSDIFFXKYNSPYHIEMGTYVLIDLLXAGGSVAPAQPTSLRXNXGIFAQTCSTCLEGPNRKDSSGAHPCRAIDRAXEPDSLCSLKAITHATGSKIWSSRSRWNRCTEYYPVGMKTHIEYPDIIVXKYNSPY
Ga0314718_1035304Ga0314718_10353042F007513VVLTVLQRVVALPVVLLVVFSTAMDHGTGALEEVLRLHAFLVVVFVRHAVDGTGDMLCLVLLTLL
Ga0314718_1035799Ga0314718_10357991F102251NNDAKIIITFLNMHGDVHYYTANFGIKIQLLYEETKKTNCFMG
Ga0314718_1036634Ga0314718_10366342F030332CEQLAALFLGNAPHEDTIGAMAVEIPFYHRVAFRQLYYALSGHIIIRKDIVFKVVPDLGDPCIGTSLRRWEWRYEVSRVLNSAHNPGRAPLMECRRTASFEVLT
Ga0314718_1037090Ga0314718_10370901F094790MVFLNCRDWGSTSGPFLHTPVSGMPEALLSNCFTADRGCGSCLGLSCSYLLQSHRELCLLGSMGLLPQNVGLLIKELIQGG
Ga0314718_1037510Ga0314718_10375101F040424DKEAIDHASTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSDKPTDDVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0314718_1038631Ga0314718_10386311F026477MFVAWLVVDLLCFVAYYLRISCCLCAVTFQSLASSYCIELVAQGQRPASFMSSRSDLLWFALVLRVGIISARLGLANGLDDPVAC
Ga0314718_1039609Ga0314718_10396091F018668HSLLSTPPPKQHQTIKMAFFKSLLIASVAAVAFAAPQGASDKNTEVKVSGQDNSPKCGNGQKIACCNSGEDLIGLNCLSIPILAIPIQQACGSNVAACCQTGDAEGNLINLEANCLAIPL
Ga0314718_1040821Ga0314718_10408211F042140TNGKVVAHKVGKKKSSWNHSIWVTKDILTNMKGPQMVWVPKET
Ga0314718_1042524Ga0314718_10425242F065367MSAEQKDLGVSAMGDGEKACPCCQFYGVPCRQARATEDEATIRRNQRLFSGTKRKRSHQEQLTEDSLFLDGPSVDELQTIQKRKDP
Ga0314718_1044990Ga0314718_10449902F076802AQYFDLPQPEQGMRIMGAYARRNMEDIDAIRRHTTQLEDGTAGIAYQMGLLGLAPSEQFNGGAFQQYYDQGYNARANQGD
Ga0314718_1046886Ga0314718_10468861F000459VRIGVLERVDNIKRGRGRPKLTWNKLVKRDLKDWNISKEIALDRSAWRLAINV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.