Basic Information | |
---|---|
Family ID | F102251 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 101 |
Average Sequence Length | 45 residues |
Representative Sequence | MKNNDEKIITIFFNMHCDVHYYPAKFEIKIQLIYGETKKINCI |
Number of Associated Samples | 74 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 0.00 % |
% of genes from short scaffolds (< 2000 bps) | 0.00 % |
Associated GOLD sequencing projects | 74 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (87.129 % of family members) |
Environment Ontology (ENVO) | Unclassified (95.050 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (64.356 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF02782 | FGGY_C | 1.98 |
PF07714 | PK_Tyr_Ser-Thr | 0.99 |
PF00342 | PGI | 0.99 |
PF07645 | EGF_CA | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.96 |
COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 87.13% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 7.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.97% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032699 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032789 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032790 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032811 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032822 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032845 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032889 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032913 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068861_1012424271 | 3300005719 | Switchgrass Rhizosphere | MKNNTEKIIINFFNMYCDVHYCSAKFEIKIQLVYGEIKNKLY* |
Ga0134125_115670312 | 3300010371 | Terrestrial Soil | KNNDEKIINFLNMHCDAHHYNAKSKIKIQLAYGETKKINCIMG* |
Ga0134127_133046481 | 3300010399 | Terrestrial Soil | MKNNDEKIITIFLNMHCDVPYYFPTFEIKIQLVYEETKKTNCIMG* |
Ga0182183_10235562 | 3300015270 | Switchgrass Phyllosphere | KNNHEKIIKNFSRHCDVHYCSTKFEIKIQLVYGETSKRNCIMGENGLNCIV* |
Ga0182100_10064431 | 3300015280 | Switchgrass Phyllosphere | TTYFNMHCDVHYYSTKFEIKIQLVYGETKRINCIIG* |
Ga0182100_10601301 | 3300015280 | Switchgrass Phyllosphere | MKNIDEKNHNIVLNMHCDIHYYPVKFEIKIQLVYGETEKINYVTG* |
Ga0182101_10687062 | 3300015284 | Switchgrass Phyllosphere | VVENFMKNNDEKIITNFFNMHCDVHYYSAKFEIKIQLVYEGTKKQIVLWGKMN* |
Ga0182105_10214191 | 3300015290 | Switchgrass Phyllosphere | RVQNYMKNNDDKFITTFFNMHCDVYYYSTKFEIKIQLVYRETKRTNYIIG* |
Ga0182104_10203481 | 3300015297 | Switchgrass Phyllosphere | NNDDKFITTFFNMHCDVHYYSTKFEIKIQLVYGETKRTNCIIG* |
Ga0182104_10667781 | 3300015297 | Switchgrass Phyllosphere | ITIFLNMHCDVPYYFPTIEIKIQLTYGEIKKTNCIIG* |
Ga0182098_10426311 | 3300015309 | Switchgrass Phyllosphere | MKNNDEKIITIFLNMHCDVPYYFPTFEIKIQLAYGEIKKTNCIIG* |
Ga0182162_10755261 | 3300015310 | Switchgrass Phyllosphere | NYMKNNTEKIIINFFNMYCDVHYCSAKFEIKIQLVYGETKNINFI* |
Ga0182182_10859251 | 3300015311 | Switchgrass Phyllosphere | MKNNDDKFITTFFNMHCDVHYYSTKFEIKIQLVYGETKRI |
Ga0182182_11065751 | 3300015311 | Switchgrass Phyllosphere | VQNYMKNNAENIITIFINMQYDVHNYPAKFEIKIQLVYGETKKTNCIIGVK* |
Ga0182164_10528051 | 3300015313 | Switchgrass Phyllosphere | KNNDDKFITTFFNMHCDVHYYSTKFEIKIQLVYGETKRINCIIG* |
Ga0182120_10756811 | 3300015315 | Switchgrass Phyllosphere | MKNNAENIITIFINMQYDVHNYPAKFEIKIQLVYGETKKTNCIMV* |
Ga0182136_10789142 | 3300015317 | Switchgrass Phyllosphere | KNNNEKLITDIFNIHCDVHYYSAKFEIKIQLVYGETKKTNCIMG* |
Ga0182153_10137641 | 3300015328 | Switchgrass Phyllosphere | KFITTFFNMHCDVHYYSTKFEIKIQLVYGETKRIKCIIG* |
Ga0182153_10300363 | 3300015328 | Switchgrass Phyllosphere | YKII*KNNDKNYNKFFKMHCDVYYYPTKFEIKIQLVYEETKKITSIMG* |
Ga0182135_10099641 | 3300015329 | Switchgrass Phyllosphere | YMKNNDEKIIIIFNNMQYDVHYYPAKFKIKIQLVYGETKKTNCIMV* |
Ga0182135_11333071 | 3300015329 | Switchgrass Phyllosphere | MKNNDEKHYNFLNMHCDVHYYSAKYEIKNQLVYGETKKINCIIE* |
Ga0182152_10004994 | 3300015330 | Switchgrass Phyllosphere | NDDKFITTFFNMHCDVYYYSTKFEIKIQLVYEEIKRINCIIG* |
Ga0182131_10730361 | 3300015331 | Switchgrass Phyllosphere | MKNNDEKLRDFFSIHCDAYYYLAKFKIKIQHVHGETKKINCVMG* |
Ga0182117_10049822 | 3300015332 | Switchgrass Phyllosphere | MKNNTEKIIIIFFNMYCDVHYCSAKFEIKIQLVYGETKNINFI* |
Ga0182117_11150031 | 3300015332 | Switchgrass Phyllosphere | IIRVQNYMKNNDEKHYNFLNMYCDVHYYSVKFDIKIQLVFGETKKTNCIME* |
Ga0182147_10058151 | 3300015333 | Switchgrass Phyllosphere | IGVQYYMKNDEKYNNFFNMHSNVRYYTVKFEIKIQLVYGVTKKTNCIMGVK* |
Ga0182147_10226331 | 3300015333 | Switchgrass Phyllosphere | MKNNTEKIIINFFNMYCDVHYCSAKFEIKIQLVYGETKNINFI* |
Ga0182132_10067932 | 3300015334 | Switchgrass Phyllosphere | MKNNIEKIIINFFNMYCDVHYCSAKFEIKIQLVYGETKNINFI* |
Ga0182116_10780541 | 3300015335 | Switchgrass Phyllosphere | MKNNDEKLRDFFSIHCDAYYYLAKFKIKIQLVYGETKKINCVMG* |
Ga0182116_11120521 | 3300015335 | Switchgrass Phyllosphere | MKNNNEKLITDIFNIHCDVHYYSAKFEIKIHLVYEETKEINCIRG* |
Ga0182116_11524911 | 3300015335 | Switchgrass Phyllosphere | MKNNDDKFITTFFNMHRDVHYYSTKFEIKIQLMYRENKRKKLYYGVK* |
Ga0182116_11774501 | 3300015335 | Switchgrass Phyllosphere | KLIIGVKNYMKNNNEKLYFFNMYCDVYYYSAKFKIKIQLVYGETKKTNCIMG* |
Ga0182150_10163974 | 3300015336 | Switchgrass Phyllosphere | MKNDDEKIIMFFNMYCDVHYAAKIEIKIQLVYAETKKKDKLFYRV* |
Ga0182150_11121801 | 3300015336 | Switchgrass Phyllosphere | TKLYENNTEKIITKFFNMYCDVHYCSAKFEIKIQLVYGETKKINFI* |
Ga0182151_10258151 | 3300015337 | Switchgrass Phyllosphere | DERSITNFFNMHCDVHCYPTKFEIKLQLVYGEIKKTNYVRGKMD* |
Ga0182151_11141761 | 3300015337 | Switchgrass Phyllosphere | MKNNDEKLYQFFNMHCDVYYYVAKFKIKIQLMYGETKK |
Ga0182137_11402171 | 3300015338 | Switchgrass Phyllosphere | SRVQNYMKNNDDKFIITFFNMHYDVHYYSTKFEIKIQLVYKETKKTNCIMG* |
Ga0182149_10769011 | 3300015339 | Switchgrass Phyllosphere | GVENFMKNNDEKIITNFFNMHCDVRYYPAKFEIKIQPVYGETK* |
Ga0182115_10640721 | 3300015348 | Switchgrass Phyllosphere | MKNNDEKIITKSFNMHCDVHYYPENFEIKIQLVYGETKNTNCI* |
Ga0182185_10037651 | 3300015349 | Switchgrass Phyllosphere | MKNNDDKFITTFFNMHCDVHYYSTKFEIKIQLVYGETKRINCIIG* |
Ga0182185_12629951 | 3300015349 | Switchgrass Phyllosphere | MKNNHEKIIKKISRHCDVHYCSTKFEIKVQLVYGETRKKIVL* |
Ga0182163_10594222 | 3300015350 | Switchgrass Phyllosphere | MKNDDEKIIMFFNMYCDVHYAAKIEIKIQLVYAETKKKTLFYRV* |
Ga0182163_10733352 | 3300015350 | Switchgrass Phyllosphere | DDKFITTFFNMHCDVHYYSTKFEIKIQLVYGETKRINCIIW* |
Ga0182163_11085012 | 3300015350 | Switchgrass Phyllosphere | MKNNDEKIIIFFNNMQYDVHYYPAKFKIKIQLVYGETKKTNYIMG* |
Ga0182163_11214201 | 3300015350 | Switchgrass Phyllosphere | MKNNNEQLITNCFNMYCDVHYRSTKFEIKIQLVYGETKNKLY |
Ga0182169_10611691 | 3300015352 | Switchgrass Phyllosphere | MKNNDEKFITNFLMCINVHYNSAKFEIKIQLVYGETKKT |
Ga0182169_10696701 | 3300015352 | Switchgrass Phyllosphere | MKNNAENIITIFINMQYDVHNYPAKFEIKIQLVYGETKKTNCIMGYNELNDIV* |
Ga0182167_10656531 | 3300015354 | Switchgrass Phyllosphere | MKNNDEKIITNFFNVHCDVYYYSAKFDIKIQLVYGETKKINCV* |
Ga0182167_10799031 | 3300015354 | Switchgrass Phyllosphere | MKNNDEKILTTFLNIHYDIHYYPTKFEIKIQLVNGEMKKINYIMV* |
Ga0182199_10346651 | 3300017412 | Switchgrass Phyllosphere | QIIKNFLNMHCDVHYYSAKFEIKIHLVYEETKEINCIRG |
Ga0182199_11680801 | 3300017412 | Switchgrass Phyllosphere | MKNNDEKIITIFFNMHCDVHYYPAKFEIKIQLIYGETKKINCI |
Ga0182195_10018561 | 3300017414 | Switchgrass Phyllosphere | VQNYMKNNIEKIIINFFNMYCDVHYCSAKFEIKIQLVYGETKNINFI |
Ga0182201_10692112 | 3300017422 | Switchgrass Phyllosphere | MKNNDEKIITIFLNMHCDVPYYFPTFEIKIQLAYGEIKKTNCIIG |
Ga0182201_10759881 | 3300017422 | Switchgrass Phyllosphere | RDYMKNDDEKIIMFFNMYCDVHYAAKIEIKIQLVYAETKKRQIVL |
Ga0182194_10620381 | 3300017435 | Switchgrass Phyllosphere | MMKNYDNFFSIHCDVYYYLAKFKIKIQLVYGETKKINCV |
Ga0182194_11130891 | 3300017435 | Switchgrass Phyllosphere | MKNNNEKLITDIFNIHCDVHYYSAKFEIKIQLVYGETKKTNCIMG |
Ga0182200_11418012 | 3300017439 | Switchgrass Phyllosphere | GVQNYMKNNDEKIIIIFNNMQYDVHYYPAKFKIKIQLVYGETKKTNCIMV |
Ga0182215_11592112 | 3300017447 | Switchgrass Phyllosphere | MKNNAENIITIFINMQYDVHNYPAKFEIKIQLVYGETKKTNCIMV |
Ga0182210_11154991 | 3300017692 | Switchgrass Phyllosphere | VQNYMKNNDEKILTTFLNIHYDIHYYPTKFEIKIQLVYGETKRINYIIG |
Ga0182118_1035882 | 3300020223 | Switchgrass Phyllosphere | MKNNDDKFITTFFNMHCDVHYYSTKFEIKIQLVFGETKRI |
Ga0207676_108921142 | 3300026095 | Switchgrass Rhizosphere | MKNNTEKIIINFFNMYCDVHYCSAKFEIKIQLVYGETKNINFI |
Ga0207676_116680701 | 3300026095 | Switchgrass Rhizosphere | GVQNYMKNNDEKILTTFLNIHYDIHYYPTKFEIKIQLVYKETKKTNCIMG |
Ga0268344_10177501 | 3300028051 | Phyllosphere | MKNNDEKILTTFLNIHYDIHYYPTKFEIKIQLVYKETKKTNCIMG |
Ga0268306_10006471 | 3300028054 | Phyllosphere | YMKNNDDKFITTFFNMHCDVHYYSTKFEIKIQLVYGETKRINCIIG |
Ga0268330_10010852 | 3300028056 | Phyllosphere | MKNNTEKIIIIFFNMYCDVHYCSAKFEIKIQLVYGETKNINFI |
Ga0268307_10025311 | 3300028470 | Phyllosphere | MKNNIEKIIINFFNMYCDVHYCSAKFEIKIQLVYGETKNI |
Ga0268327_10132371 | 3300028475 | Phyllosphere | MKNNDDKSITIFFNMHCDVHYYSTKFEIKIQFVYGETKKIN |
Ga0268309_10130001 | 3300028477 | Phyllosphere | MKNNDEKIITKSFNMHCDVHYYPENFEIKIQLVYGETKNTNCI |
Ga0268339_10001941 | 3300028526 | Phyllosphere | MKNNDDKFITTFFNMHCDVHYYSTKFEIKIQLVYGETKRIKCIIG |
Ga0268335_10025391 | 3300028527 | Phyllosphere | MKNNDDKFITTFFNMHCDVHYYSTKFEIKIQLVYGETKRINYI |
Ga0214492_10428501 | 3300032464 | Switchgrass Phyllosphere | MKNNDKRIITIFFNIHYDVHYYSAKFEIKIQLMYGETKKTNCIWGKMD |
Ga0214493_10442972 | 3300032465 | Switchgrass Phyllosphere | IFNNKLILGVQNYVKNNDAKIIITFLNMHCDVHYYTAKFGIKIQLLYEETKKTNCFMG |
Ga0214503_10277001 | 3300032466 | Switchgrass Phyllosphere | MKNNDEKHYNFLNMHCDVHYYSAKFDIKIQLVFGETKKTNCIME |
Ga0214503_11631021 | 3300032466 | Switchgrass Phyllosphere | MKNNDKRIITIFFNMHYDVHYYSAKFEIKIQLMYGETKKTNCIWGKMD |
Ga0214491_10527591 | 3300032469 | Switchgrass Phyllosphere | YMKNNDEKHYNFLNMYCDVHYYSVKFDIKIQLVFGETKKTNCIME |
Ga0214491_10600243 | 3300032469 | Switchgrass Phyllosphere | QNYVKNNDAKIIITFLNMHCDVHYYTAKFGIKIQLLYEETKKTNCFMG |
Ga0214490_10405322 | 3300032502 | Switchgrass Phyllosphere | MKNNDEKHYNFLNMYCDVHYYSVKFDIKIQLVFGETKKTNCIME |
Ga0214502_11313812 | 3300032514 | Switchgrass Phyllosphere | FRIFNNKLILGVQNYVKNNDAKIIITFLNMHCDVHYYTAKFGIKIQLLYEETKKTNCFMG |
Ga0321339_10770121 | 3300032551 | Switchgrass Phyllosphere | VQNYVKNNDAKIIITFLNMHCDVHYYTANFGIKIQLLYEETKKTNCFMG |
Ga0321338_11480553 | 3300032593 | Switchgrass Phyllosphere | KNNDAKIIITFLNMHCDVHYYTAKFGIKIQLLYEETKKTNCFMG |
Ga0214497_10407011 | 3300032689 | Switchgrass Phyllosphere | IFNNKLILGVQNYVKNNDAKIIITFLNMHCDVHYYTAKFGIKIQLLYEETKKTNCFME |
Ga0214494_10257391 | 3300032699 | Switchgrass Phyllosphere | RVQNYMKNNDEKHYNFLNMYCDVHYYSVKFDIKIQLVFGETKKTNCIME |
Ga0214494_10316603 | 3300032699 | Switchgrass Phyllosphere | RIFNNKLILGVQNYVKNNDAKIIITFLNMHCDVHYYTAKFGIKIQLWYEETKKTNCFME |
Ga0314746_10825952 | 3300032758 | Switchgrass Phyllosphere | VQNYVKNNDAKIIITFLNMHCDVHYYTAKFGIKIQLLYEETKKTNCFMG |
Ga0314733_10020333 | 3300032761 | Switchgrass Phyllosphere | VQNYMKNNDEKHYNFLNMYCDVHYYSVKFDIKIQLVFGETKKTNCIME |
Ga0314725_10130113 | 3300032789 | Switchgrass Phyllosphere | LGVQNYVKNNDAKIIITFLNMHCDVHYYTAKFGIKIQLLYEETKKTNCFMG |
Ga0314731_10217331 | 3300032790 | Switchgrass Phyllosphere | MKNNDKRIITIFFNIHYDVHYYSAKFEIKIQLMYGETKKDKVYMG |
Ga0314744_10032161 | 3300032792 | Switchgrass Phyllosphere | NYMKNNDEKFITNFLMCINVHYNSAKFEIKIQLVYGETKKTKCIMG |
Ga0314718_10357991 | 3300032811 | Switchgrass Phyllosphere | NNDAKIIITFLNMHGDVHYYTANFGIKIQLLYEETKKTNCFMG |
Ga0314740_10012202 | 3300032822 | Switchgrass Phyllosphere | MKNNDGKHYNFFNMHCDVHYYSAKFDIKIQLVFGETKKTNCIME |
Ga0314740_10299361 | 3300032822 | Switchgrass Phyllosphere | NNDAKIIITFLNMLCDVHYYTAKFGIKIQLLYEETKKTNCFMG |
Ga0314723_10352402 | 3300032823 | Switchgrass Phyllosphere | FRIYNKLILGVQNYVKNNNAKIIITFLNMHCDVHYYTAKFGIKIQLLYEETKKTNCFMG |
Ga0314743_10100901 | 3300032844 | Switchgrass Phyllosphere | GVQNYMKNNDEKFITNFLMCINVHYNSAKFEIKIQLVYGETKKTKCIMG |
Ga0314727_10205151 | 3300032845 | Switchgrass Phyllosphere | KLILGVQNYVKNNDAKIIITFLNMHCDVHYYTAKFGIKIQLLYEETKKTNCFMG |
Ga0314751_10022803 | 3300032889 | Switchgrass Phyllosphere | MKNNDEKHYNFLNMHCDVHCYSAKFDIKIQLVFGETKKTNCIME |
Ga0314739_10600742 | 3300032913 | Switchgrass Phyllosphere | VQNNDEKIISKFFNMHCDAHYHTAKFETKIQLVHGETKKTNCIMG |
Ga0314734_10369191 | 3300032916 | Switchgrass Phyllosphere | IIITFLNMHCDVHYYTAKFGIKIQLLYEETKKTNCFMG |
Ga0314761_10121152 | 3300033526 | Switchgrass Phyllosphere | MKNNDEKHYNFLNMYCDVHYYSVKFDIKIQLVFVETKKTNCIME |
Ga0314767_10986131 | 3300033532 | Switchgrass Phyllosphere | IIITFLNMHCDVHYYTANFGIKIQLLYEETKKTNCFMG |
Ga0314757_10062992 | 3300033534 | Switchgrass Phyllosphere | MKNNDKRIITIFFNIHYDVHYYSAKFEIKIQLMYGETK |
Ga0314757_11665111 | 3300033534 | Switchgrass Phyllosphere | MKNNDEKIITNFFNVHCDVYYYSTKFDIKIQLVYGETKKINYIMG |
⦗Top⦘ |