 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029045 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127429 | Gp0193655 | Ga0169661 |
| Sample Name | Human fecal microbial communities from mother in Denmark - 343_M |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 130858951 |
| Sequencing Scaffolds | 9 |
| Novel Protein Genes | 9 |
| Associated Families | 9 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
| All Organisms → Viruses → Predicted Viral | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Oscillospiraceae bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. Marseille-Q4896 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Denmark | |||||||
| Coordinates | Lat. (o) | 55.678 | Long. (o) | 12.531 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026489 | Metagenome | 197 | N |
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F055715 | Metagenome | 138 | N |
| F055775 | Metagenome | 138 | N |
| F076189 | Metagenome | 118 | N |
| F081453 | Metagenome | 114 | N |
| F088921 | Metagenome | 109 | N |
| F089053 | Metagenome | 109 | Y |
| F090514 | Metagenome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0169661_100124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 102217 | Open in IMG/M |
| Ga0169661_105979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3059 | Open in IMG/M |
| Ga0169661_107782 | All Organisms → Viruses → Predicted Viral | 2463 | Open in IMG/M |
| Ga0169661_110270 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| Ga0169661_112229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia | 1685 | Open in IMG/M |
| Ga0169661_121580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1005 | Open in IMG/M |
| Ga0169661_124427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Oscillospiraceae bacterium | 889 | Open in IMG/M |
| Ga0169661_124484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 887 | Open in IMG/M |
| Ga0169661_140539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. Marseille-Q4896 | 540 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0169661_100124 | Ga0169661_10012499 | F089053 | MEGPRPDKFAFGVRIGREVDGCRPAKGCVKKRIYESANGQPELSTAAEANVKNMEAFL |
| Ga0169661_105979 | Ga0169661_1059791 | F026592 | RTASPQGIDAQASQGSVAPLMERSDETFSGMQLFSADRE |
| Ga0169661_107782 | Ga0169661_1077822 | F055775 | MAQIAQQDNLVIEVTTTAAALDSATKKKLIECIEGGTITDVILVTKEDEKKISHARVVGWLVDTTADSPKYTIDIINANGGTVTAIKLN |
| Ga0169661_110270 | Ga0169661_1102702 | F055715 | LTKANEFDKINELLIERTAKKFERVSKNKLKKFLTNEKFCDKINELIQVGTAEILDN |
| Ga0169661_112229 | Ga0169661_1122293 | F081453 | MFPFFLLAGENIIEKHIFANPVCGTNIKAPEPAVKVTPGRKFM |
| Ga0169661_121580 | Ga0169661_1215802 | F026489 | SDFDALEPRKRGCSPLLTPKRRAAPEKTEDSRLFGVKIF |
| Ga0169661_124427 | Ga0169661_1244272 | F088921 | LGGCKKIAVKTSALGATIRLYKIGAGKNHFLCSEKSKSTVFDLDRETKKRKYAKETCRIYIEKDQNMQEEKKEKYINGEIYGEKNQIIVANKLAMIRYKMWSK |
| Ga0169661_124484 | Ga0169661_1244842 | F090514 | MNLRIHALKKASRQRPGVKTAAARFFSILYYPFCAKRSSFFQQNVQPRGNFFAKRPIFVYFADILPRLTGAKWFVILLTIVPAGSRARAGSSLPLSPASIFF |
| Ga0169661_140539 | Ga0169661_1405391 | F076189 | VLSAGHCFFLSPFIKPLLYVEKLQIGTVLPVVSDLYREFAELLACFDLHAIQSAQKQLHMLCNFHENTLGLLIFYTDYAII |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |