NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F080453

Metagenome Family F080453

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080453
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 47 residues
Representative Sequence DDFFLSSINFDETKHYVRKVMNSYKRYAEIYGNAGPQGGIRPEP
Number of Associated Samples 100
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.87 %
% of genes near scaffold ends (potentially truncated) 96.52 %
% of genes from short scaffolds (< 2000 bps) 92.17 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.174 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(11.304 % of family members)
Environment Ontology (ENVO) Unclassified
(33.913 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(53.913 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.50%    β-sheet: 0.00%    Coil/Unstructured: 62.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF00534Glycos_transf_1 26.09
PF00072Response_reg 13.91
PF13439Glyco_transf_4 9.57
PF044632-thiour_desulf 5.22
PF07617DUF1579 1.74
PF16193AAA_assoc_2 1.74
PF14534DUF4440 1.74
PF09424YqeY 1.74
PF10041DUF2277 0.87
PF01464SLT 0.87
PF13188PAS_8 0.87
PF00082Peptidase_S8 0.87
PF12681Glyoxalase_2 0.87
PF12002MgsA_C 0.87
PF01967MoaC 0.87
PF00147Fibrinogen_C 0.87
PF15919HicB_lk_antitox 0.87
PF07681DoxX 0.87
PF13602ADH_zinc_N_2 0.87
PF01734Patatin 0.87
PF10079BshC 0.87
PF03449GreA_GreB_N 0.87
PF04199Cyclase 0.87
PF02844GARS_N 0.87
PF02585PIG-L 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG1683Uncharacterized conserved protein YbbK, DUF523 familyFunction unknown [S] 5.22
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 0.87
COG0315Molybdenum cofactor biosynthesis enzyme MoaCCoenzyme transport and metabolism [H] 0.87
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.87
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.87
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.87
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.87
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.87
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.87
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.87
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.17 %
UnclassifiedrootN/A7.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_110972200All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300002025|smpD1_1156028All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300004081|Ga0063454_100652820All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300004114|Ga0062593_102331382All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300004114|Ga0062593_102948760All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300004156|Ga0062589_102810077All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300004463|Ga0063356_104927602All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300004479|Ga0062595_101667262All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005166|Ga0066674_10111956All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300005176|Ga0066679_11000058All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005294|Ga0065705_10767097All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300005329|Ga0070683_100985937All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300005343|Ga0070687_100876391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300005440|Ga0070705_101220012All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300005467|Ga0070706_100690803All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300005471|Ga0070698_101633127All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300005534|Ga0070735_10920477All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005536|Ga0070697_100198764All Organisms → cellular organisms → Bacteria1704Open in IMG/M
3300005544|Ga0070686_100389175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1057Open in IMG/M
3300005559|Ga0066700_10176331All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300005559|Ga0066700_10827851Not Available621Open in IMG/M
3300005564|Ga0070664_100591019All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300005616|Ga0068852_102306452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300005719|Ga0068861_101620107All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300005905|Ga0075269_10051581All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300006028|Ga0070717_10953826All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300006028|Ga0070717_11694930All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300006172|Ga0075018_10326618All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300006177|Ga0075362_10064878All Organisms → cellular organisms → Bacteria1657Open in IMG/M
3300006195|Ga0075366_10008637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes5672Open in IMG/M
3300006358|Ga0068871_100390256All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300006358|Ga0068871_101066191All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300006796|Ga0066665_10365133All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300006844|Ga0075428_102430737All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300006853|Ga0075420_100061825All Organisms → cellular organisms → Bacteria3322Open in IMG/M
3300006876|Ga0079217_10404686All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300006904|Ga0075424_100315971All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300006914|Ga0075436_100496026All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300006918|Ga0079216_10792995All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300009012|Ga0066710_100698006All Organisms → cellular organisms → Bacteria1547Open in IMG/M
3300009012|Ga0066710_100994981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1294Open in IMG/M
3300009012|Ga0066710_103889931All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300009089|Ga0099828_11380868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300009090|Ga0099827_11799568All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300009147|Ga0114129_13038386All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300009156|Ga0111538_11945356All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300009837|Ga0105058_1197814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300010400|Ga0134122_12384319All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300010400|Ga0134122_13215731Not Available512Open in IMG/M
3300011270|Ga0137391_10026580All Organisms → cellular organisms → Bacteria4824Open in IMG/M
3300011271|Ga0137393_11620713All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Abyssubacteria → Candidatus Abyssubacteria bacterium SURF_17536Open in IMG/M
3300011402|Ga0137356_1074300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300011432|Ga0137428_1052842All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1079Open in IMG/M
3300011992|Ga0120146_1032632All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300012010|Ga0120118_1007437All Organisms → cellular organisms → Bacteria3277Open in IMG/M
3300012199|Ga0137383_11055711Not Available590Open in IMG/M
3300012203|Ga0137399_10693049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci857Open in IMG/M
3300012212|Ga0150985_111054683All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300012212|Ga0150985_120786620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300012349|Ga0137387_11213412All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300012354|Ga0137366_11148852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300012358|Ga0137368_10636536All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012363|Ga0137390_10210805All Organisms → cellular organisms → Bacteria1929Open in IMG/M
3300012532|Ga0137373_10018605All Organisms → cellular organisms → Bacteria6988Open in IMG/M
3300012893|Ga0157284_10022895All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300013306|Ga0163162_10977313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium957Open in IMG/M
3300013308|Ga0157375_10000328All Organisms → cellular organisms → Bacteria42651Open in IMG/M
3300013772|Ga0120158_10208393All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1013Open in IMG/M
3300014326|Ga0157380_12441869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300014326|Ga0157380_12477391Not Available584Open in IMG/M
3300014326|Ga0157380_13056604All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300014745|Ga0157377_10778567All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300015161|Ga0167623_1039502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1007Open in IMG/M
3300015190|Ga0167651_1004435All Organisms → cellular organisms → Bacteria3274Open in IMG/M
3300018056|Ga0184623_10065877All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300018078|Ga0184612_10362761All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300018468|Ga0066662_10782897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium923Open in IMG/M
3300022756|Ga0222622_11446699All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300022880|Ga0247792_1088588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300024186|Ga0247688_1046562All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300025893|Ga0207682_10216087Not Available886Open in IMG/M
3300025910|Ga0207684_10848070All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300025910|Ga0207684_10903860All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300025910|Ga0207684_11294378Not Available600Open in IMG/M
3300025922|Ga0207646_10971708All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Abyssubacteria → Candidatus Abyssubacteria bacterium SURF_17751Open in IMG/M
3300025922|Ga0207646_11041300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300025922|Ga0207646_11754113All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300025925|Ga0207650_10014065All Organisms → cellular organisms → Bacteria5557Open in IMG/M
3300025936|Ga0207670_11754820All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium528Open in IMG/M
3300025939|Ga0207665_10910657All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300025944|Ga0207661_10519715All Organisms → cellular organisms → Bacteria → Acidobacteria1089Open in IMG/M
3300025945|Ga0207679_10444256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1149Open in IMG/M
3300025945|Ga0207679_11277169All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300026035|Ga0207703_12163429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300026116|Ga0207674_11355288All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium681Open in IMG/M
3300026118|Ga0207675_101756971All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300026550|Ga0209474_10249077All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300026552|Ga0209577_10220146All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300027283|Ga0209643_1057904All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300027875|Ga0209283_10573032Not Available718Open in IMG/M
3300027882|Ga0209590_10826217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300027886|Ga0209486_11220710All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium SM23_81517Open in IMG/M
3300027986|Ga0209168_10612367All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300028072|Ga0247675_1075224All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300028281|Ga0247689_1065302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300028381|Ga0268264_10093916All Organisms → cellular organisms → Bacteria2592Open in IMG/M
3300028810|Ga0307294_10150509All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300028824|Ga0307310_10744751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300031164|Ga0307502_10024053All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300031716|Ga0310813_11561157Not Available616Open in IMG/M
3300031820|Ga0307473_10210999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1161Open in IMG/M
3300032180|Ga0307471_100903903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1050Open in IMG/M
3300032205|Ga0307472_100486846Not Available1059Open in IMG/M
3300033407|Ga0214472_10432551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1231Open in IMG/M
3300034164|Ga0364940_0163312All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium645Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.30%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.48%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.61%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.61%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.74%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.74%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.74%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.74%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.74%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.74%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.87%
Permafrost And Active Layer SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.87%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.87%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.87%
Deep SurbsurfaceEnvironmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Surbsurface0.87%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.87%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002025Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_D1EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005905Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011992Permafrost microbial communities from Nunavut, Canada - A23_65cm_12MEnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015161Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin)EnvironmentalOpen in IMG/M
3300015190Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027283Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/37_all (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028281Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300031164Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_SEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11097220013300000956SoilPHQARLWSRLAPGPGDDEFLATVNFDETKGYLRKVLNSYDRYLEIYPEGAQAASAAGP*
smpD1_115602813300002025Permafrost And Active Layer SoilSSINFDETKDYVRKVMNSYRRYSEIYGNAGPQGGLRAEP*
Ga0063454_10065282023300004081SoilDFFLSSINFDETKQYVRKVMNSYQRYQELYGSAGPQGGVRMEP*
Ga0062593_10233138223300004114SoilVALWSRMAPAPGDDYFLSAVSFDETKQYVRKVLNSYKRYLEIYGNAGPQGGVRMEP*
Ga0062593_10294876013300004114SoilWSRLSAGDGDDFFFSAINFDETKNYVRKVLNSYQRYAEIYGGHEPVGGIRVEP*
Ga0062589_10281007713300004156SoilDDYFLTAVNFDETKHYIRKVMNSYERYTEIYGEAGPKGGLRVEP*
Ga0063356_10492760223300004463Arabidopsis Thaliana RhizosphereGADAFLTTINFEETKNYVRKVLNSYERYGEIYEGQPPVGGIRVEP*
Ga0062595_10166726213300004479SoilGPGDDFFLSSINFDETKQYVRKVMNSYKRYAEIYGNAGPQGGVRLEP*
Ga0066674_1011195623300005166SoilQRLSPGPGDDFLLSSIDFDETKQYVRKVMNSYKRYAEIYGNAGPQGGVRLEP*
Ga0066679_1100005823300005176SoilFLSSINFDETKQYVRKVMNSYKRYTEIYGNAGPQGGIRIEP*
Ga0065705_1076709723300005294Switchgrass RhizosphereQADAFFSSTTFDQTKNYVRKVLNSYERYGEIYEQAGPAGGLRLEP*
Ga0070683_10098593733300005329Corn RhizosphereKQVALWSRLAPAPGADFFLSSINFDETKQYVRKVNNSYQRYAEIYGGAGPQGGVRVEP*
Ga0070687_10087639113300005343Switchgrass RhizospherePGDDYFLTAINFDETKDYVRKVMNSYERYSEIYGNAGPKGGLRVEP*
Ga0070705_10122001213300005440Corn, Switchgrass And Miscanthus RhizosphereLAPAPGDDALFSSINFDETKHYVRKVMNSYERYGEIYGNGAPAGGVRAEP*
Ga0070706_10069080313300005467Corn, Switchgrass And Miscanthus RhizosphereDDFFLSSINFDETKHYVRKVMNSYKRYAEIYGNAGPQGGIRPEP*
Ga0070698_10163312713300005471Corn, Switchgrass And Miscanthus RhizosphereFSSISFDETKNYVRKVLNSYERYGEIYEQSGPTGGLRIEP*
Ga0070735_1092047713300005534Surface SoilKLWKRLAPGDGDDFFLSSINFDETKNYVRKVMNSYKRYTELYGNAGPQGGIRIEP*
Ga0070697_10019876413300005536Corn, Switchgrass And Miscanthus RhizosphereGPFQARLWARMAPAPGDDTYLSAINFDETKDYVRKVLNSYEGYGEIYEKQPPAGGVQATP
Ga0070686_10038917523300005544Switchgrass RhizosphereGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENTPPAGGVRPDP*
Ga0066700_1017633123300005559SoilLWERLSPAAGDDFFLSSINFDETKQYVRKVMNSYKRYTEIYGNAGPQGGIRIEP*
Ga0066700_1082785113300005559SoilINFDETKDYVRKVLNSYERYGEIYEKQPPAGGVQATP*
Ga0070664_10059101923300005564Corn RhizosphereALWSRLAPGPGDDYFLSAINFDETKQYVRKVMNSYKRYVEIYGDGKPSGGIRPEP*
Ga0068852_10230645223300005616Corn RhizosphereLSAVNFDETKHYVRKVMNSYERYREIYEAGAPAGGVRAEP*
Ga0068861_10162010713300005719Switchgrass RhizosphereATLWERMAAAPGEDFFLTAVTFEETKDYVRKVLNSYYRYGEIYSRQEPSGGVRAEP*
Ga0075269_1005158113300005905Rice Paddy SoilINFGETKDYVRKVMNSYKRYGEIYGNAGPAGGLRAEP*
Ga0070717_1095382633300006028Corn, Switchgrass And Miscanthus RhizospherePGDDFFLSAINFDETKNYVRKVMNSYKRYVEIYGNGAPAGGIRAEP*
Ga0070717_1169493023300006028Corn, Switchgrass And Miscanthus RhizosphereDDFFLSSINFDETKQYVRKVMNSYKRYAEIYGNAGPQGGIRMEP*
Ga0075018_1032661813300006172WatershedsPNQVRLWSRLAPAAGDDYFLSSINFDETKHYVRKVMNSYRRYREIYGGAGPQGGIREEP*
Ga0075362_1006487813300006177Populus EndosphereFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP*
Ga0075366_1000863713300006195Populus EndosphereDDMFLSAINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP*
Ga0068871_10039025623300006358Miscanthus RhizosphereGPGDDFFLSSINFDETKSYVRKVMNSYRRYSEIYGNAGPQGGLRAEP*
Ga0068871_10106619113300006358Miscanthus RhizosphereINFDETKDYVRKVLNSYERYGEIYENTPPAGGVRPDP*
Ga0066665_1036513313300006796SoilQARLWARLAPAGGHDFFLSSINFDETKDYVRKVMNSYERYGEIYGEG*
Ga0075428_10243073723300006844Populus RhizospherePNQSKLWARMAPAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP*
Ga0075420_10006182553300006853Populus RhizosphereSKLWARMAPAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP*
Ga0079217_1040468613300006876Agricultural SoilYNAGPKQVALWNRMQAGPGDDYFLTAVNFDETKHYVRKVMNSYERYAEIYGNAGPKGGLRAET*
Ga0075424_10031597133300006904Populus RhizospherePAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP*
Ga0075436_10049602613300006914Populus RhizosphereNFDETKQYVRKVMNSYKRYAEIYSNAGPQGGVRMEP*
Ga0079216_1079299523300006918Agricultural SoilPGVDQYLTAINFDETKNYVRKVVNSYERYREIYESGPPSGGIRPEP*
Ga0066710_10069800643300009012Grasslands SoilPRPDALFSSISFDETKNYVRKVLNSYERYGEIYEQSGPTGGLRLEP
Ga0066710_10099498123300009012Grasslands SoilFLSSINFDETKQYVRKVMNSYKRYAEIYGNAGPQGGIRIEP
Ga0066710_10388993123300009012Grasslands SoilNFDETKQYVRKVMNSYKRYAEIYGNAGPQGGIRMEP
Ga0099828_1138086823300009089Vadose Zone SoilNFDETKDYVRKVLNSYERYGEIYEKQPPAGGVQATP*
Ga0099827_1179956813300009090Vadose Zone SoilLINFDETKDYVRKVMNSYRRYQEIYGNAGPQGGLKAEP*
Ga0114129_1303838623300009147Populus RhizosphereRLAPAAGDDFFLSSINFDETKDYVRKVMNSYKRYDEIYGAGGKGGGLRAEP*
Ga0111538_1194535623300009156Populus RhizosphereHDYFLSTVSFSETRHYVRKVLNSYERYGEIYQGEPPTGGVRAEP*
Ga0105058_119781413300009837Groundwater SandLWARMAPAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENQPPTGGVRPDP*
Ga0134122_1238431923300010400Terrestrial SoilADAFFSSTSFDQTKNYVRKVLNSYERYGEIYEQAGPAGGLRLEP*
Ga0134122_1321573113300010400Terrestrial SoilFLSAINFDETKQYVRKVMNSYKRYAEIYGNGVPSGGIRPEP*
Ga0137391_1002658013300011270Vadose Zone SoilDLYLSSINFDETKDYVRKVLNSYERYGEIYENQPPTGGVRPDP*
Ga0137393_1162071323300011271Vadose Zone SoilWTRLSPAKGDDFFLSSINFDETKQYVRKVMNSYKRYAEIYGNAGPQGGIRMEP*
Ga0137356_107430013300011402SoilKQAHVWERMAPGPGDDQYLTAINFDETKNYVRKVLNSYERYREIYESGPPSGGVRPEP*
Ga0137428_105284213300011432SoilMAPGPGDDQYLTAINFDETKNYVRKVLNSYERYREIYESGPPSGGVRPEP*
Ga0120146_103263213300011992PermafrostWSRLAPAPGDDWFLSSINFDETKDYVRKVMNSYRRYSEIYGNAGPQGGLRAEP*
Ga0120118_100743713300012010PermafrostMPPAPGDDWFLSSINFDETKDYVRKVMNSYRRYSEIYGNAGPQGGLRAEP*
Ga0137383_1105571123300012199Vadose Zone SoilNFDETKQYVRKVMNSYKRYAEIYGNAGPQGGVRIEP*
Ga0137399_1069304923300012203Vadose Zone SoilFDETKDYIRKVMNSYRRYAELYGNAGPQGGLKAEP*
Ga0150985_11105468313300012212Avena Fatua RhizosphereINFDETKDYVRKVLNSYERYGEIYDQGPPSGGVQSVP*
Ga0150985_12078662023300012212Avena Fatua RhizosphereNFDETKDYVRKVLNSYERYGEIYENQAPTGGVRPEP*
Ga0137387_1121341213300012349Vadose Zone SoilFDETKQYVRKVMNSYERYGEIYGNGAPAGGVRAEP*
Ga0137366_1114885213300012354Vadose Zone SoilHQVALWGRLTPAAGDDFFLSSINFDETKDYVRKVLNSYERYGEVYENQPPTGGVRPDP*
Ga0137368_1063653613300012358Vadose Zone SoilAPGDDFFLTAVSFDETKNYVRKVMNSYRRYAEIYGGAGPQGGVRAEP*
Ga0137390_1021080533300012363Vadose Zone SoilAGPNQAKLWARMAPAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENQPPTGGVRPDP*
Ga0137373_1001860513300012532Vadose Zone SoilDFFLSSINFAETKQYVRKVMNSYKRYAEIYGNAGPQGGIRVEP*
Ga0157284_1002289533300012893SoilLWVRLAPAGGHDFFLSAVNFDETKDYVRKVLNSYERYGEIYENQPPAGGVRPDP*
Ga0163162_1097731323300013306Switchgrass RhizosphereFDETKDYVRKVLNSYERYGEIYENQPPAGGVRPDP*
Ga0157375_1000032813300013308Miscanthus RhizosphereKQTALWSRLAPAPGDDYFLSAINFDETKQYVRKVMNSYKRYSEIYGNGVPSGGIRPEP*
Ga0120158_1020839323300013772PermafrostKQVALWSRLAPAPGDDWFLSSINFDETKDYVRKVMNSYRRYSEIYGNAGPQGGLRAEP*
Ga0157380_1244186923300014326Switchgrass RhizosphereKQSHLWERMQPGPGDDQFLTAVNFDETKNYVRKVLNSYERYREIYESGPPSGGLRPEP*
Ga0157380_1247739123300014326Switchgrass RhizosphereGDDYFLASINFDETKHYVRKVMNSYKRYGEIYGSTGPAGGIQIEP*
Ga0157380_1305660413300014326Switchgrass RhizosphereFLSSINFDETKDYVRKVMNSYRRYGEIYGHAGPQGGLRAEP*
Ga0157377_1077856713300014745Miscanthus RhizosphereLWSRIQAGEGDDYFLTAVNFDETKHYVRKVMNSYERYSAIYGDAAPRGGLRAEP*
Ga0167623_103950223300015161Glacier Forefield SoilAINFDETKQYVRKVMNSYKRYVEIYGDGKPSGGIRPEP*
Ga0167651_100443573300015190Glacier Forefield SoilFLSAINFDETKQYVRKVMNSYKRYEEIYGNGVPSGGIRPEP*
Ga0184623_1006587753300018056Groundwater SedimentAISFDETKNYVRKVLNSYERYGEIYERAGPTGGLRIEP
Ga0184612_1036276133300018078Groundwater SedimentRPDAFFTAISFDETKNYVRKVLNSYERYGEIYEQVGPTGGLRIEP
Ga0066662_1078289713300018468Grasslands SoilNQAKLWARLAPAGGHDFFLSSINFDETKDYVRKVMNSYERYGEIYGEG
Ga0222622_1144669923300022756Groundwater SedimentLTAINFDETKNYVRKVLNSYERYREIYESGPPSGGIRPEP
Ga0247792_108858823300022880SoilNQSKLWARMAPAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENQPPAGGVRPDP
Ga0247688_104656213300024186SoilLAPSPGDDYFLSAINFDETKQYVRKVMNSYKRYMEIYGDGNPSGGIRPEP
Ga0207682_1021608713300025893Miscanthus RhizosphereDDYFLSSINFDETKDYVRKVMNSYRRYGEIYGHAGPQGGLRAEP
Ga0207684_1084807013300025910Corn, Switchgrass And Miscanthus RhizospherePAEGDDFFLSSINFDETKHYVRKVMNSYKRYAEIYGNAGPQGGIRAEP
Ga0207684_1090386013300025910Corn, Switchgrass And Miscanthus RhizosphereAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENQPPTGGVRPDP
Ga0207684_1129437823300025910Corn, Switchgrass And Miscanthus RhizosphereRLAPAEGDDFFLSSINFDETKHYVRKVMNSYKRYAEIYGNAGPQGGIRPEP
Ga0207646_1097170823300025922Corn, Switchgrass And Miscanthus RhizosphereFFLSSINFDETKHYVRKVMNSYKRYMEIYGNAGPQGGIRMEP
Ga0207646_1104130013300025922Corn, Switchgrass And Miscanthus RhizosphereLSAINFDETKDYVRKVLNSYERYGEIYENQPPTGGVRPDP
Ga0207646_1175411313300025922Corn, Switchgrass And Miscanthus RhizosphereLSSINFDETKHYVRKVMNSYKRYAEIYGNAGPQGGIRAEP
Ga0207650_1001406573300025925Switchgrass RhizosphereAGPKQTALWSRLAPAAGDDYFLSAINFDETKHYVRKVMNSYKRYVAIYGDGKPSGGIRPE
Ga0207670_1175482013300025936Switchgrass RhizospherePAPGDDYFLTAINFDETKHYVRKVMNSYERYAEIYGNAGPKGGLRAEP
Ga0207665_1091065723300025939Corn, Switchgrass And Miscanthus RhizosphereLAPAPGDDYFLSAINFDETKQYVRKVMNSYKRYAEIYGDGNPSGGIRPEP
Ga0207661_1051971543300025944Corn RhizosphereLAPAPGADFFLSSINFDETKQYVRKVNNSYQRYAEIYGGAGPQGGVRVEP
Ga0207679_1044425613300025945Corn RhizosphereGPKQTALWSRLAPGPGDDYFLSAINFDETKQYVRKVMNSYKRYVEIYGDGKPSGGIRPEP
Ga0207679_1127716913300025945Corn RhizosphereAVNFDETKHYVRKVMNSYERYNEIYGNGGAAGGMRAEP
Ga0207703_1216342913300026035Switchgrass RhizosphereDMFLSAINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP
Ga0207674_1135528823300026116Corn RhizosphereMSANQVALWSRLSPAPGDDFFLSSINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPD
Ga0207675_10175697123300026118Switchgrass RhizosphereFDETKDYVRKVLNSYERYGEIYENQPPAGGVRPDP
Ga0209474_1024907723300026550SoilLSSINFDETKQYVRKVMNSYRRYTEIYGNAGPQGGIRMEP
Ga0209577_1022014613300026552SoilSSINFDETKQYVRKVMNSYKRYAEIYGNAGPQGGIRMEP
Ga0209643_105790423300027283Deep SurbsurfaceAGPFQTRLWSRLQPAEGDDYFLSSVNFSETKHYVRKVMNSYRRYGEIYEGGPVSGGIPAE
Ga0209283_1057303213300027875Vadose Zone SoilPAAGDDYFLSSINFDETKHYVRKVMNSYKRYAEIYGGGGPVGGVRAEP
Ga0209590_1082621713300027882Vadose Zone SoilLINFDETKDYVRKVMNSYRRYQEIYGNAGPQGGLKAEP
Ga0209486_1122071023300027886Agricultural SoilAEGDDYFLTAVNFDETKHYIRKVMNSYERYTEIYGEGGPKGGLRVEP
Ga0209168_1061236723300027986Surface SoilQVKLWKRLAPGDGDDFFLSSINFDETKNYVRKVMNSYKRYTELYGNAGPQGGIRIEP
Ga0247675_107522423300028072SoilSAINFDETKQYVRKVMNSYKRYAEIYGDGNPSGGIRPEP
Ga0247689_106530223300028281SoilAGPKQTALWSRMAPSPGDDYFLSAINFDETKQYVRKVMNSYKRYAEIYGDGNPSGGIRPE
Ga0268264_1009391613300028381Switchgrass RhizosphereAPAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENQPPAGGVRPDP
Ga0307294_1015050933300028810SoilGAGDDQFLTAVNFDETKNYVRKVLNSYERYREIYESGPPSGGIRPEP
Ga0307310_1074475123300028824SoilSISFDETKNYVRKVLNSYERYGEIYERSGPAGGLRLEP
Ga0307502_1002405323300031164SoilPAEGEDYFLTAVNFDETKHYIGKVMNSYERYSEIYGSAGPKGGLRAEP
Ga0310813_1156115723300031716SoilAVSFDETKNYVRKVMNSYKRYAELYGNAGPQGGIRPEP
Ga0307473_1021099913300031820Hardwood Forest SoilSSINFDETKQYVRKVMNSYRRYTEIYGNAGPQGGIRVEP
Ga0307471_10090390313300032180Hardwood Forest SoilASDDDFFLSSINFDETKQYVRKVMNSYRRYTEIYGNAGPQGGIRVEP
Ga0307472_10048684633300032205Hardwood Forest SoilPHQTALWSRLAAGPGDDYFLTVVSFDETKNYVRKVMNSYRRYAEIYGGAGPQGGVRAEP
Ga0214472_1043255133300033407SoilPNQARLWARMAPAAGNDMFLTAINFDETKDYVRKVLNSYERYAEIYENQPPAGGVRPEP
Ga0364940_0163312_1_1503300034164SedimentAPGPGDDQYLTAINFDETKNYVRKVLNSYERYREIYESGPPSGGIRPEP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.