| Basic Information | |
|---|---|
| Family ID | F080453 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 47 residues |
| Representative Sequence | DDFFLSSINFDETKHYVRKVMNSYKRYAEIYGNAGPQGGIRPEP |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.87 % |
| % of genes near scaffold ends (potentially truncated) | 96.52 % |
| % of genes from short scaffolds (< 2000 bps) | 92.17 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.174 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (11.304 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.913 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.913 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00534 | Glycos_transf_1 | 26.09 |
| PF00072 | Response_reg | 13.91 |
| PF13439 | Glyco_transf_4 | 9.57 |
| PF04463 | 2-thiour_desulf | 5.22 |
| PF07617 | DUF1579 | 1.74 |
| PF16193 | AAA_assoc_2 | 1.74 |
| PF14534 | DUF4440 | 1.74 |
| PF09424 | YqeY | 1.74 |
| PF10041 | DUF2277 | 0.87 |
| PF01464 | SLT | 0.87 |
| PF13188 | PAS_8 | 0.87 |
| PF00082 | Peptidase_S8 | 0.87 |
| PF12681 | Glyoxalase_2 | 0.87 |
| PF12002 | MgsA_C | 0.87 |
| PF01967 | MoaC | 0.87 |
| PF00147 | Fibrinogen_C | 0.87 |
| PF15919 | HicB_lk_antitox | 0.87 |
| PF07681 | DoxX | 0.87 |
| PF13602 | ADH_zinc_N_2 | 0.87 |
| PF01734 | Patatin | 0.87 |
| PF10079 | BshC | 0.87 |
| PF03449 | GreA_GreB_N | 0.87 |
| PF04199 | Cyclase | 0.87 |
| PF02844 | GARS_N | 0.87 |
| PF02585 | PIG-L | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1683 | Uncharacterized conserved protein YbbK, DUF523 family | Function unknown [S] | 5.22 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.87 |
| COG0315 | Molybdenum cofactor biosynthesis enzyme MoaC | Coenzyme transport and metabolism [H] | 0.87 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.87 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.87 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.87 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.87 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.87 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.87 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.87 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.17 % |
| Unclassified | root | N/A | 7.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_110972200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300002025|smpD1_1156028 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300004081|Ga0063454_100652820 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300004114|Ga0062593_102331382 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300004114|Ga0062593_102948760 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300004156|Ga0062589_102810077 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300004463|Ga0063356_104927602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300004479|Ga0062595_101667262 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005166|Ga0066674_10111956 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300005176|Ga0066679_11000058 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005294|Ga0065705_10767097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300005329|Ga0070683_100985937 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005343|Ga0070687_100876391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300005440|Ga0070705_101220012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300005467|Ga0070706_100690803 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300005471|Ga0070698_101633127 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005534|Ga0070735_10920477 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005536|Ga0070697_100198764 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300005544|Ga0070686_100389175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1057 | Open in IMG/M |
| 3300005559|Ga0066700_10176331 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300005559|Ga0066700_10827851 | Not Available | 621 | Open in IMG/M |
| 3300005564|Ga0070664_100591019 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300005616|Ga0068852_102306452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300005719|Ga0068861_101620107 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005905|Ga0075269_10051581 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300006028|Ga0070717_10953826 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300006028|Ga0070717_11694930 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006172|Ga0075018_10326618 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300006177|Ga0075362_10064878 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300006195|Ga0075366_10008637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 5672 | Open in IMG/M |
| 3300006358|Ga0068871_100390256 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300006358|Ga0068871_101066191 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300006796|Ga0066665_10365133 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300006844|Ga0075428_102430737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300006853|Ga0075420_100061825 | All Organisms → cellular organisms → Bacteria | 3322 | Open in IMG/M |
| 3300006876|Ga0079217_10404686 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300006904|Ga0075424_100315971 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300006914|Ga0075436_100496026 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300006918|Ga0079216_10792995 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009012|Ga0066710_100698006 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300009012|Ga0066710_100994981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1294 | Open in IMG/M |
| 3300009012|Ga0066710_103889931 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300009089|Ga0099828_11380868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300009090|Ga0099827_11799568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300009147|Ga0114129_13038386 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009156|Ga0111538_11945356 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300009837|Ga0105058_1197814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300010400|Ga0134122_12384319 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010400|Ga0134122_13215731 | Not Available | 512 | Open in IMG/M |
| 3300011270|Ga0137391_10026580 | All Organisms → cellular organisms → Bacteria | 4824 | Open in IMG/M |
| 3300011271|Ga0137393_11620713 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Abyssubacteria → Candidatus Abyssubacteria bacterium SURF_17 | 536 | Open in IMG/M |
| 3300011402|Ga0137356_1074300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300011432|Ga0137428_1052842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
| 3300011992|Ga0120146_1032632 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300012010|Ga0120118_1007437 | All Organisms → cellular organisms → Bacteria | 3277 | Open in IMG/M |
| 3300012199|Ga0137383_11055711 | Not Available | 590 | Open in IMG/M |
| 3300012203|Ga0137399_10693049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 857 | Open in IMG/M |
| 3300012212|Ga0150985_111054683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300012212|Ga0150985_120786620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300012349|Ga0137387_11213412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300012354|Ga0137366_11148852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300012358|Ga0137368_10636536 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012363|Ga0137390_10210805 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300012532|Ga0137373_10018605 | All Organisms → cellular organisms → Bacteria | 6988 | Open in IMG/M |
| 3300012893|Ga0157284_10022895 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300013306|Ga0163162_10977313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300013308|Ga0157375_10000328 | All Organisms → cellular organisms → Bacteria | 42651 | Open in IMG/M |
| 3300013772|Ga0120158_10208393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1013 | Open in IMG/M |
| 3300014326|Ga0157380_12441869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300014326|Ga0157380_12477391 | Not Available | 584 | Open in IMG/M |
| 3300014326|Ga0157380_13056604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300014745|Ga0157377_10778567 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300015161|Ga0167623_1039502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300015190|Ga0167651_1004435 | All Organisms → cellular organisms → Bacteria | 3274 | Open in IMG/M |
| 3300018056|Ga0184623_10065877 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300018078|Ga0184612_10362761 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300018468|Ga0066662_10782897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300022756|Ga0222622_11446699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300022880|Ga0247792_1088588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300024186|Ga0247688_1046562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300025893|Ga0207682_10216087 | Not Available | 886 | Open in IMG/M |
| 3300025910|Ga0207684_10848070 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300025910|Ga0207684_10903860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300025910|Ga0207684_11294378 | Not Available | 600 | Open in IMG/M |
| 3300025922|Ga0207646_10971708 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Abyssubacteria → Candidatus Abyssubacteria bacterium SURF_17 | 751 | Open in IMG/M |
| 3300025922|Ga0207646_11041300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300025922|Ga0207646_11754113 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300025925|Ga0207650_10014065 | All Organisms → cellular organisms → Bacteria | 5557 | Open in IMG/M |
| 3300025936|Ga0207670_11754820 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 528 | Open in IMG/M |
| 3300025939|Ga0207665_10910657 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300025944|Ga0207661_10519715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300025945|Ga0207679_10444256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1149 | Open in IMG/M |
| 3300025945|Ga0207679_11277169 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300026035|Ga0207703_12163429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300026116|Ga0207674_11355288 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 681 | Open in IMG/M |
| 3300026118|Ga0207675_101756971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300026550|Ga0209474_10249077 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300026552|Ga0209577_10220146 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300027283|Ga0209643_1057904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300027875|Ga0209283_10573032 | Not Available | 718 | Open in IMG/M |
| 3300027882|Ga0209590_10826217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300027886|Ga0209486_11220710 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium SM23_81 | 517 | Open in IMG/M |
| 3300027986|Ga0209168_10612367 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300028072|Ga0247675_1075224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300028281|Ga0247689_1065302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300028381|Ga0268264_10093916 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300028810|Ga0307294_10150509 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300028824|Ga0307310_10744751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300031164|Ga0307502_10024053 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300031716|Ga0310813_11561157 | Not Available | 616 | Open in IMG/M |
| 3300031820|Ga0307473_10210999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 3300032180|Ga0307471_100903903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
| 3300032205|Ga0307472_100486846 | Not Available | 1059 | Open in IMG/M |
| 3300033407|Ga0214472_10432551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1231 | Open in IMG/M |
| 3300034164|Ga0364940_0163312 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 645 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.61% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.61% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.74% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.74% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.87% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Permafrost And Active Layer Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.87% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.87% |
| Deep Surbsurface | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Surbsurface | 0.87% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.87% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002025 | Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_D1 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005905 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011402 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027283 | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/37_all (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300031164 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1109722001 | 3300000956 | Soil | PHQARLWSRLAPGPGDDEFLATVNFDETKGYLRKVLNSYDRYLEIYPEGAQAASAAGP* |
| smpD1_11560281 | 3300002025 | Permafrost And Active Layer Soil | SSINFDETKDYVRKVMNSYRRYSEIYGNAGPQGGLRAEP* |
| Ga0063454_1006528202 | 3300004081 | Soil | DFFLSSINFDETKQYVRKVMNSYQRYQELYGSAGPQGGVRMEP* |
| Ga0062593_1023313822 | 3300004114 | Soil | VALWSRMAPAPGDDYFLSAVSFDETKQYVRKVLNSYKRYLEIYGNAGPQGGVRMEP* |
| Ga0062593_1029487601 | 3300004114 | Soil | WSRLSAGDGDDFFFSAINFDETKNYVRKVLNSYQRYAEIYGGHEPVGGIRVEP* |
| Ga0062589_1028100771 | 3300004156 | Soil | DDYFLTAVNFDETKHYIRKVMNSYERYTEIYGEAGPKGGLRVEP* |
| Ga0063356_1049276022 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GADAFLTTINFEETKNYVRKVLNSYERYGEIYEGQPPVGGIRVEP* |
| Ga0062595_1016672621 | 3300004479 | Soil | GPGDDFFLSSINFDETKQYVRKVMNSYKRYAEIYGNAGPQGGVRLEP* |
| Ga0066674_101119562 | 3300005166 | Soil | QRLSPGPGDDFLLSSIDFDETKQYVRKVMNSYKRYAEIYGNAGPQGGVRLEP* |
| Ga0066679_110000582 | 3300005176 | Soil | FLSSINFDETKQYVRKVMNSYKRYTEIYGNAGPQGGIRIEP* |
| Ga0065705_107670972 | 3300005294 | Switchgrass Rhizosphere | QADAFFSSTTFDQTKNYVRKVLNSYERYGEIYEQAGPAGGLRLEP* |
| Ga0070683_1009859373 | 3300005329 | Corn Rhizosphere | KQVALWSRLAPAPGADFFLSSINFDETKQYVRKVNNSYQRYAEIYGGAGPQGGVRVEP* |
| Ga0070687_1008763911 | 3300005343 | Switchgrass Rhizosphere | PGDDYFLTAINFDETKDYVRKVMNSYERYSEIYGNAGPKGGLRVEP* |
| Ga0070705_1012200121 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LAPAPGDDALFSSINFDETKHYVRKVMNSYERYGEIYGNGAPAGGVRAEP* |
| Ga0070706_1006908031 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DDFFLSSINFDETKHYVRKVMNSYKRYAEIYGNAGPQGGIRPEP* |
| Ga0070698_1016331271 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FSSISFDETKNYVRKVLNSYERYGEIYEQSGPTGGLRIEP* |
| Ga0070735_109204771 | 3300005534 | Surface Soil | KLWKRLAPGDGDDFFLSSINFDETKNYVRKVMNSYKRYTELYGNAGPQGGIRIEP* |
| Ga0070697_1001987641 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GPFQARLWARMAPAPGDDTYLSAINFDETKDYVRKVLNSYEGYGEIYEKQPPAGGVQATP |
| Ga0070686_1003891752 | 3300005544 | Switchgrass Rhizosphere | GDDMFLSAINFDETKDYVRKVLNSYERYGEIYENTPPAGGVRPDP* |
| Ga0066700_101763312 | 3300005559 | Soil | LWERLSPAAGDDFFLSSINFDETKQYVRKVMNSYKRYTEIYGNAGPQGGIRIEP* |
| Ga0066700_108278511 | 3300005559 | Soil | INFDETKDYVRKVLNSYERYGEIYEKQPPAGGVQATP* |
| Ga0070664_1005910192 | 3300005564 | Corn Rhizosphere | ALWSRLAPGPGDDYFLSAINFDETKQYVRKVMNSYKRYVEIYGDGKPSGGIRPEP* |
| Ga0068852_1023064522 | 3300005616 | Corn Rhizosphere | LSAVNFDETKHYVRKVMNSYERYREIYEAGAPAGGVRAEP* |
| Ga0068861_1016201071 | 3300005719 | Switchgrass Rhizosphere | ATLWERMAAAPGEDFFLTAVTFEETKDYVRKVLNSYYRYGEIYSRQEPSGGVRAEP* |
| Ga0075269_100515811 | 3300005905 | Rice Paddy Soil | INFGETKDYVRKVMNSYKRYGEIYGNAGPAGGLRAEP* |
| Ga0070717_109538263 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PGDDFFLSAINFDETKNYVRKVMNSYKRYVEIYGNGAPAGGIRAEP* |
| Ga0070717_116949302 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DDFFLSSINFDETKQYVRKVMNSYKRYAEIYGNAGPQGGIRMEP* |
| Ga0075018_103266181 | 3300006172 | Watersheds | PNQVRLWSRLAPAAGDDYFLSSINFDETKHYVRKVMNSYRRYREIYGGAGPQGGIREEP* |
| Ga0075362_100648781 | 3300006177 | Populus Endosphere | FDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP* |
| Ga0075366_100086371 | 3300006195 | Populus Endosphere | DDMFLSAINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP* |
| Ga0068871_1003902562 | 3300006358 | Miscanthus Rhizosphere | GPGDDFFLSSINFDETKSYVRKVMNSYRRYSEIYGNAGPQGGLRAEP* |
| Ga0068871_1010661911 | 3300006358 | Miscanthus Rhizosphere | INFDETKDYVRKVLNSYERYGEIYENTPPAGGVRPDP* |
| Ga0066665_103651331 | 3300006796 | Soil | QARLWARLAPAGGHDFFLSSINFDETKDYVRKVMNSYERYGEIYGEG* |
| Ga0075428_1024307372 | 3300006844 | Populus Rhizosphere | PNQSKLWARMAPAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP* |
| Ga0075420_1000618255 | 3300006853 | Populus Rhizosphere | SKLWARMAPAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP* |
| Ga0079217_104046861 | 3300006876 | Agricultural Soil | YNAGPKQVALWNRMQAGPGDDYFLTAVNFDETKHYVRKVMNSYERYAEIYGNAGPKGGLRAET* |
| Ga0075424_1003159713 | 3300006904 | Populus Rhizosphere | PAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP* |
| Ga0075436_1004960261 | 3300006914 | Populus Rhizosphere | NFDETKQYVRKVMNSYKRYAEIYSNAGPQGGVRMEP* |
| Ga0079216_107929952 | 3300006918 | Agricultural Soil | PGVDQYLTAINFDETKNYVRKVVNSYERYREIYESGPPSGGIRPEP* |
| Ga0066710_1006980064 | 3300009012 | Grasslands Soil | PRPDALFSSISFDETKNYVRKVLNSYERYGEIYEQSGPTGGLRLEP |
| Ga0066710_1009949812 | 3300009012 | Grasslands Soil | FLSSINFDETKQYVRKVMNSYKRYAEIYGNAGPQGGIRIEP |
| Ga0066710_1038899312 | 3300009012 | Grasslands Soil | NFDETKQYVRKVMNSYKRYAEIYGNAGPQGGIRMEP |
| Ga0099828_113808682 | 3300009089 | Vadose Zone Soil | NFDETKDYVRKVLNSYERYGEIYEKQPPAGGVQATP* |
| Ga0099827_117995681 | 3300009090 | Vadose Zone Soil | LINFDETKDYVRKVMNSYRRYQEIYGNAGPQGGLKAEP* |
| Ga0114129_130383862 | 3300009147 | Populus Rhizosphere | RLAPAAGDDFFLSSINFDETKDYVRKVMNSYKRYDEIYGAGGKGGGLRAEP* |
| Ga0111538_119453562 | 3300009156 | Populus Rhizosphere | HDYFLSTVSFSETRHYVRKVLNSYERYGEIYQGEPPTGGVRAEP* |
| Ga0105058_11978141 | 3300009837 | Groundwater Sand | LWARMAPAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENQPPTGGVRPDP* |
| Ga0134122_123843192 | 3300010400 | Terrestrial Soil | ADAFFSSTSFDQTKNYVRKVLNSYERYGEIYEQAGPAGGLRLEP* |
| Ga0134122_132157311 | 3300010400 | Terrestrial Soil | FLSAINFDETKQYVRKVMNSYKRYAEIYGNGVPSGGIRPEP* |
| Ga0137391_100265801 | 3300011270 | Vadose Zone Soil | DLYLSSINFDETKDYVRKVLNSYERYGEIYENQPPTGGVRPDP* |
| Ga0137393_116207132 | 3300011271 | Vadose Zone Soil | WTRLSPAKGDDFFLSSINFDETKQYVRKVMNSYKRYAEIYGNAGPQGGIRMEP* |
| Ga0137356_10743001 | 3300011402 | Soil | KQAHVWERMAPGPGDDQYLTAINFDETKNYVRKVLNSYERYREIYESGPPSGGVRPEP* |
| Ga0137428_10528421 | 3300011432 | Soil | MAPGPGDDQYLTAINFDETKNYVRKVLNSYERYREIYESGPPSGGVRPEP* |
| Ga0120146_10326321 | 3300011992 | Permafrost | WSRLAPAPGDDWFLSSINFDETKDYVRKVMNSYRRYSEIYGNAGPQGGLRAEP* |
| Ga0120118_10074371 | 3300012010 | Permafrost | MPPAPGDDWFLSSINFDETKDYVRKVMNSYRRYSEIYGNAGPQGGLRAEP* |
| Ga0137383_110557112 | 3300012199 | Vadose Zone Soil | NFDETKQYVRKVMNSYKRYAEIYGNAGPQGGVRIEP* |
| Ga0137399_106930492 | 3300012203 | Vadose Zone Soil | FDETKDYIRKVMNSYRRYAELYGNAGPQGGLKAEP* |
| Ga0150985_1110546831 | 3300012212 | Avena Fatua Rhizosphere | INFDETKDYVRKVLNSYERYGEIYDQGPPSGGVQSVP* |
| Ga0150985_1207866202 | 3300012212 | Avena Fatua Rhizosphere | NFDETKDYVRKVLNSYERYGEIYENQAPTGGVRPEP* |
| Ga0137387_112134121 | 3300012349 | Vadose Zone Soil | FDETKQYVRKVMNSYERYGEIYGNGAPAGGVRAEP* |
| Ga0137366_111488521 | 3300012354 | Vadose Zone Soil | HQVALWGRLTPAAGDDFFLSSINFDETKDYVRKVLNSYERYGEVYENQPPTGGVRPDP* |
| Ga0137368_106365361 | 3300012358 | Vadose Zone Soil | APGDDFFLTAVSFDETKNYVRKVMNSYRRYAEIYGGAGPQGGVRAEP* |
| Ga0137390_102108053 | 3300012363 | Vadose Zone Soil | AGPNQAKLWARMAPAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENQPPTGGVRPDP* |
| Ga0137373_100186051 | 3300012532 | Vadose Zone Soil | DFFLSSINFAETKQYVRKVMNSYKRYAEIYGNAGPQGGIRVEP* |
| Ga0157284_100228953 | 3300012893 | Soil | LWVRLAPAGGHDFFLSAVNFDETKDYVRKVLNSYERYGEIYENQPPAGGVRPDP* |
| Ga0163162_109773132 | 3300013306 | Switchgrass Rhizosphere | FDETKDYVRKVLNSYERYGEIYENQPPAGGVRPDP* |
| Ga0157375_100003281 | 3300013308 | Miscanthus Rhizosphere | KQTALWSRLAPAPGDDYFLSAINFDETKQYVRKVMNSYKRYSEIYGNGVPSGGIRPEP* |
| Ga0120158_102083932 | 3300013772 | Permafrost | KQVALWSRLAPAPGDDWFLSSINFDETKDYVRKVMNSYRRYSEIYGNAGPQGGLRAEP* |
| Ga0157380_124418692 | 3300014326 | Switchgrass Rhizosphere | KQSHLWERMQPGPGDDQFLTAVNFDETKNYVRKVLNSYERYREIYESGPPSGGLRPEP* |
| Ga0157380_124773912 | 3300014326 | Switchgrass Rhizosphere | GDDYFLASINFDETKHYVRKVMNSYKRYGEIYGSTGPAGGIQIEP* |
| Ga0157380_130566041 | 3300014326 | Switchgrass Rhizosphere | FLSSINFDETKDYVRKVMNSYRRYGEIYGHAGPQGGLRAEP* |
| Ga0157377_107785671 | 3300014745 | Miscanthus Rhizosphere | LWSRIQAGEGDDYFLTAVNFDETKHYVRKVMNSYERYSAIYGDAAPRGGLRAEP* |
| Ga0167623_10395022 | 3300015161 | Glacier Forefield Soil | AINFDETKQYVRKVMNSYKRYVEIYGDGKPSGGIRPEP* |
| Ga0167651_10044357 | 3300015190 | Glacier Forefield Soil | FLSAINFDETKQYVRKVMNSYKRYEEIYGNGVPSGGIRPEP* |
| Ga0184623_100658775 | 3300018056 | Groundwater Sediment | AISFDETKNYVRKVLNSYERYGEIYERAGPTGGLRIEP |
| Ga0184612_103627613 | 3300018078 | Groundwater Sediment | RPDAFFTAISFDETKNYVRKVLNSYERYGEIYEQVGPTGGLRIEP |
| Ga0066662_107828971 | 3300018468 | Grasslands Soil | NQAKLWARLAPAGGHDFFLSSINFDETKDYVRKVMNSYERYGEIYGEG |
| Ga0222622_114466992 | 3300022756 | Groundwater Sediment | LTAINFDETKNYVRKVLNSYERYREIYESGPPSGGIRPEP |
| Ga0247792_10885882 | 3300022880 | Soil | NQSKLWARMAPAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENQPPAGGVRPDP |
| Ga0247688_10465621 | 3300024186 | Soil | LAPSPGDDYFLSAINFDETKQYVRKVMNSYKRYMEIYGDGNPSGGIRPEP |
| Ga0207682_102160871 | 3300025893 | Miscanthus Rhizosphere | DDYFLSSINFDETKDYVRKVMNSYRRYGEIYGHAGPQGGLRAEP |
| Ga0207684_108480701 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PAEGDDFFLSSINFDETKHYVRKVMNSYKRYAEIYGNAGPQGGIRAEP |
| Ga0207684_109038601 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | APGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENQPPTGGVRPDP |
| Ga0207684_112943782 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RLAPAEGDDFFLSSINFDETKHYVRKVMNSYKRYAEIYGNAGPQGGIRPEP |
| Ga0207646_109717082 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FFLSSINFDETKHYVRKVMNSYKRYMEIYGNAGPQGGIRMEP |
| Ga0207646_110413001 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LSAINFDETKDYVRKVLNSYERYGEIYENQPPTGGVRPDP |
| Ga0207646_117541131 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LSSINFDETKHYVRKVMNSYKRYAEIYGNAGPQGGIRAEP |
| Ga0207650_100140657 | 3300025925 | Switchgrass Rhizosphere | AGPKQTALWSRLAPAAGDDYFLSAINFDETKHYVRKVMNSYKRYVAIYGDGKPSGGIRPE |
| Ga0207670_117548201 | 3300025936 | Switchgrass Rhizosphere | PAPGDDYFLTAINFDETKHYVRKVMNSYERYAEIYGNAGPKGGLRAEP |
| Ga0207665_109106572 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LAPAPGDDYFLSAINFDETKQYVRKVMNSYKRYAEIYGDGNPSGGIRPEP |
| Ga0207661_105197154 | 3300025944 | Corn Rhizosphere | LAPAPGADFFLSSINFDETKQYVRKVNNSYQRYAEIYGGAGPQGGVRVEP |
| Ga0207679_104442561 | 3300025945 | Corn Rhizosphere | GPKQTALWSRLAPGPGDDYFLSAINFDETKQYVRKVMNSYKRYVEIYGDGKPSGGIRPEP |
| Ga0207679_112771691 | 3300025945 | Corn Rhizosphere | AVNFDETKHYVRKVMNSYERYNEIYGNGGAAGGMRAEP |
| Ga0207703_121634291 | 3300026035 | Switchgrass Rhizosphere | DMFLSAINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPDP |
| Ga0207674_113552882 | 3300026116 | Corn Rhizosphere | MSANQVALWSRLSPAPGDDFFLSSINFDETKDYVRKVLNSYERYGEIYENAPPAGGVRPD |
| Ga0207675_1017569712 | 3300026118 | Switchgrass Rhizosphere | FDETKDYVRKVLNSYERYGEIYENQPPAGGVRPDP |
| Ga0209474_102490772 | 3300026550 | Soil | LSSINFDETKQYVRKVMNSYRRYTEIYGNAGPQGGIRMEP |
| Ga0209577_102201461 | 3300026552 | Soil | SSINFDETKQYVRKVMNSYKRYAEIYGNAGPQGGIRMEP |
| Ga0209643_10579042 | 3300027283 | Deep Surbsurface | AGPFQTRLWSRLQPAEGDDYFLSSVNFSETKHYVRKVMNSYRRYGEIYEGGPVSGGIPAE |
| Ga0209283_105730321 | 3300027875 | Vadose Zone Soil | PAAGDDYFLSSINFDETKHYVRKVMNSYKRYAEIYGGGGPVGGVRAEP |
| Ga0209590_108262171 | 3300027882 | Vadose Zone Soil | LINFDETKDYVRKVMNSYRRYQEIYGNAGPQGGLKAEP |
| Ga0209486_112207102 | 3300027886 | Agricultural Soil | AEGDDYFLTAVNFDETKHYIRKVMNSYERYTEIYGEGGPKGGLRVEP |
| Ga0209168_106123672 | 3300027986 | Surface Soil | QVKLWKRLAPGDGDDFFLSSINFDETKNYVRKVMNSYKRYTELYGNAGPQGGIRIEP |
| Ga0247675_10752242 | 3300028072 | Soil | SAINFDETKQYVRKVMNSYKRYAEIYGDGNPSGGIRPEP |
| Ga0247689_10653022 | 3300028281 | Soil | AGPKQTALWSRMAPSPGDDYFLSAINFDETKQYVRKVMNSYKRYAEIYGDGNPSGGIRPE |
| Ga0268264_100939161 | 3300028381 | Switchgrass Rhizosphere | APAPGDDMFLSAINFDETKDYVRKVLNSYERYGEIYENQPPAGGVRPDP |
| Ga0307294_101505093 | 3300028810 | Soil | GAGDDQFLTAVNFDETKNYVRKVLNSYERYREIYESGPPSGGIRPEP |
| Ga0307310_107447512 | 3300028824 | Soil | SISFDETKNYVRKVLNSYERYGEIYERSGPAGGLRLEP |
| Ga0307502_100240532 | 3300031164 | Soil | PAEGEDYFLTAVNFDETKHYIGKVMNSYERYSEIYGSAGPKGGLRAEP |
| Ga0310813_115611572 | 3300031716 | Soil | AVSFDETKNYVRKVMNSYKRYAELYGNAGPQGGIRPEP |
| Ga0307473_102109991 | 3300031820 | Hardwood Forest Soil | SSINFDETKQYVRKVMNSYRRYTEIYGNAGPQGGIRVEP |
| Ga0307471_1009039031 | 3300032180 | Hardwood Forest Soil | ASDDDFFLSSINFDETKQYVRKVMNSYRRYTEIYGNAGPQGGIRVEP |
| Ga0307472_1004868463 | 3300032205 | Hardwood Forest Soil | PHQTALWSRLAAGPGDDYFLTVVSFDETKNYVRKVMNSYRRYAEIYGGAGPQGGVRAEP |
| Ga0214472_104325513 | 3300033407 | Soil | PNQARLWARMAPAAGNDMFLTAINFDETKDYVRKVLNSYERYAEIYENQPPAGGVRPEP |
| Ga0364940_0163312_1_150 | 3300034164 | Sediment | APGPGDDQYLTAINFDETKNYVRKVLNSYERYREIYESGPPSGGIRPEP |
| ⦗Top⦘ |