3300026863: Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300026863
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0110132 | Gp0095973 | Ga0209902
• Sample Name: Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 118759663
• Sequencing Scaffolds: 5
• Novel Protein Genes: 5
• Associated Families: 5

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Cyanobacterial Communities From The Joint Genome Institute, California, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → microbial mat material
• Earth Microbiome Project Ontology (EMPO): na → na → na

Location Information

• Location: USA: California
• Coordinates
  • Lat. (^o): 37.9313884
  • Long. (^o): -122.0239394
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008003	Metagenome / Metatranscriptome	341	Y
F023883	Metagenome / Metatranscriptome	208	Y
F059129	Metagenome / Metatranscriptome	134	Y
F078433	Metagenome / Metatranscriptome	116	Y
F098177	Metagenome / Metatranscriptome	104	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0209902_102581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4899
Ga0209902_102680	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4665
Ga0209902_103672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3159
Ga0209902_105759	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1835
Ga0209902_106834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1488

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209902_102581	Ga0209902_1025812	F059129	MRTAIFAAAAACLIAVPATAGEVRSTDMSSQGVYIEGPGVGVRVGPDRPRYREGWRERQVRGGGGCKTVTVRETMPDGTRVKRTRSNC
Ga0209902_102680	Ga0209902_1026807	F098177	MSNENQKPVAPTTKVDTAKTPSAPQQNQGDAKPSTEKPTVQQK
Ga0209902_103672	Ga0209902_1036723	F008003	MIFSDLPSPAEALPTQKRLSKGSAQAGNRLPLLGIML
Ga0209902_105759	Ga0209902_1057594	F078433	LLMSGALYDPPRVINHLGPQASAVGWQIASTLRMW
Ga0209902_106834	Ga0209902_1068342	F023883	MPPAPKRKPADDPTAPDPDKNARLETYEQEVERASVDSIAEHPDGSAPPLERLVDAHPEKQRKPLP