| Basic Information | |
|---|---|
| Family ID | F078433 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTTFSLR |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.96 % |
| % of genes near scaffold ends (potentially truncated) | 20.69 % |
| % of genes from short scaffolds (< 2000 bps) | 83.62 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.724 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.517 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.241 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.414 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF12697 | Abhydrolase_6 | 22.41 |
| PF12973 | Cupin_7 | 8.62 |
| PF00561 | Abhydrolase_1 | 8.62 |
| PF08386 | Abhydrolase_4 | 5.17 |
| PF00501 | AMP-binding | 0.86 |
| PF00994 | MoCF_biosynth | 0.86 |
| PF00676 | E1_dh | 0.86 |
| PF06233 | Usg | 0.86 |
| PF00132 | Hexapep | 0.86 |
| PF10722 | YbjN | 0.86 |
| PF05175 | MTS | 0.86 |
| PF05096 | Glu_cyclase_2 | 0.86 |
| PF00156 | Pribosyltran | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.86 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.86 |
| COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.72 % |
| Unclassified | root | N/A | 23.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0545298 | Not Available | 706 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105775434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
| 3300002568|C688J35102_118415350 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300003319|soilL2_10220194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1711 | Open in IMG/M |
| 3300004114|Ga0062593_102736317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300004156|Ga0062589_100703027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300004156|Ga0062589_102087834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
| 3300004643|Ga0062591_100683176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 925 | Open in IMG/M |
| 3300005093|Ga0062594_101786182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300005175|Ga0066673_10232831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1062 | Open in IMG/M |
| 3300005184|Ga0066671_10192016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1222 | Open in IMG/M |
| 3300005330|Ga0070690_100049745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2673 | Open in IMG/M |
| 3300005333|Ga0070677_10003593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5003 | Open in IMG/M |
| 3300005343|Ga0070687_100697308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300005364|Ga0070673_101137491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
| 3300005438|Ga0070701_10362287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 909 | Open in IMG/M |
| 3300005543|Ga0070672_101144509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300005544|Ga0070686_101209722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300005560|Ga0066670_10463998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300005575|Ga0066702_10321299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300005577|Ga0068857_101591033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300005719|Ga0068861_101430212 | Not Available | 676 | Open in IMG/M |
| 3300005843|Ga0068860_102519861 | Not Available | 534 | Open in IMG/M |
| 3300005844|Ga0068862_102167216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300006800|Ga0066660_11177581 | Not Available | 603 | Open in IMG/M |
| 3300009094|Ga0111539_10856716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1057 | Open in IMG/M |
| 3300009101|Ga0105247_10386925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 993 | Open in IMG/M |
| 3300009148|Ga0105243_10473001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1181 | Open in IMG/M |
| 3300009156|Ga0111538_13038917 | Not Available | 586 | Open in IMG/M |
| 3300009176|Ga0105242_12577567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
| 3300009551|Ga0105238_10169058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2162 | Open in IMG/M |
| 3300009553|Ga0105249_10913584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 945 | Open in IMG/M |
| 3300009840|Ga0126313_10222817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1454 | Open in IMG/M |
| 3300010038|Ga0126315_10861352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300010039|Ga0126309_10091654 | Not Available | 1548 | Open in IMG/M |
| 3300010039|Ga0126309_10703875 | Not Available | 649 | Open in IMG/M |
| 3300010045|Ga0126311_10005039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6989 | Open in IMG/M |
| 3300010045|Ga0126311_11885352 | Not Available | 508 | Open in IMG/M |
| 3300010335|Ga0134063_10645010 | Not Available | 543 | Open in IMG/M |
| 3300010399|Ga0134127_10204688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1838 | Open in IMG/M |
| 3300010400|Ga0134122_12612657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300011244|Ga0137483_100027 | All Organisms → cellular organisms → Bacteria | 119304 | Open in IMG/M |
| 3300012200|Ga0137382_10845979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300012212|Ga0150985_120818046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 833 | Open in IMG/M |
| 3300012906|Ga0157295_10011520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1584 | Open in IMG/M |
| 3300012917|Ga0137395_11001929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300012922|Ga0137394_11366522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300012925|Ga0137419_10559442 | Not Available | 914 | Open in IMG/M |
| 3300012944|Ga0137410_11629882 | Not Available | 566 | Open in IMG/M |
| 3300012985|Ga0164308_11872163 | Not Available | 559 | Open in IMG/M |
| 3300012986|Ga0164304_11090711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300013297|Ga0157378_11562783 | Not Available | 705 | Open in IMG/M |
| 3300013306|Ga0163162_10920597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 987 | Open in IMG/M |
| 3300014325|Ga0163163_13279362 | Not Available | 505 | Open in IMG/M |
| 3300014326|Ga0157380_10615713 | Not Available | 1077 | Open in IMG/M |
| 3300014326|Ga0157380_10895643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 913 | Open in IMG/M |
| 3300014326|Ga0157380_11656040 | Not Available | 696 | Open in IMG/M |
| 3300014326|Ga0157380_12215973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300014968|Ga0157379_10167295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1985 | Open in IMG/M |
| 3300015053|Ga0137405_1377965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1821 | Open in IMG/M |
| 3300015064|Ga0167641_128283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300015069|Ga0167633_100487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15110 | Open in IMG/M |
| 3300015158|Ga0167622_1000147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 41849 | Open in IMG/M |
| 3300015161|Ga0167623_1000189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 26920 | Open in IMG/M |
| 3300015200|Ga0173480_11253816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 17Sr1-1 | 503 | Open in IMG/M |
| 3300015241|Ga0137418_10639856 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300015374|Ga0132255_100899650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1323 | Open in IMG/M |
| 3300015374|Ga0132255_101914445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300018000|Ga0184604_10279018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300018066|Ga0184617_1085130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 863 | Open in IMG/M |
| 3300018071|Ga0184618_10442656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300018073|Ga0184624_10009124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3386 | Open in IMG/M |
| 3300018083|Ga0184628_10681169 | Not Available | 514 | Open in IMG/M |
| 3300018422|Ga0190265_10132521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2404 | Open in IMG/M |
| 3300018429|Ga0190272_10001786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10309 | Open in IMG/M |
| 3300018431|Ga0066655_11116323 | Not Available | 553 | Open in IMG/M |
| 3300018432|Ga0190275_10151279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2139 | Open in IMG/M |
| 3300018433|Ga0066667_11591198 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300018468|Ga0066662_10335794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1291 | Open in IMG/M |
| 3300018468|Ga0066662_10875477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
| 3300018476|Ga0190274_10409357 | Not Available | 1319 | Open in IMG/M |
| 3300018482|Ga0066669_10631339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 941 | Open in IMG/M |
| 3300018482|Ga0066669_10788958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 840 | Open in IMG/M |
| 3300019362|Ga0173479_10076100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1179 | Open in IMG/M |
| 3300019377|Ga0190264_10230267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1054 | Open in IMG/M |
| 3300019883|Ga0193725_1023124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1689 | Open in IMG/M |
| 3300020005|Ga0193697_1009180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2411 | Open in IMG/M |
| 3300020016|Ga0193696_1018652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1867 | Open in IMG/M |
| 3300020060|Ga0193717_1016057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3355 | Open in IMG/M |
| 3300022756|Ga0222622_10518441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
| 3300022756|Ga0222622_10766441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300025315|Ga0207697_10341128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 665 | Open in IMG/M |
| 3300025893|Ga0207682_10002565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8112 | Open in IMG/M |
| 3300025901|Ga0207688_10087698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1784 | Open in IMG/M |
| 3300025918|Ga0207662_10232822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1204 | Open in IMG/M |
| 3300025926|Ga0207659_11027569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300025934|Ga0207686_11097317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300025937|Ga0207669_10350394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1140 | Open in IMG/M |
| 3300025942|Ga0207689_11711120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 521 | Open in IMG/M |
| 3300025945|Ga0207679_11790310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300026118|Ga0207675_100608181 | Not Available | 1096 | Open in IMG/M |
| 3300026312|Ga0209153_1122586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 984 | Open in IMG/M |
| 3300026863|Ga0209902_105759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1835 | Open in IMG/M |
| 3300027907|Ga0207428_11287250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300028563|Ga0265319_1227395 | Not Available | 570 | Open in IMG/M |
| 3300028876|Ga0307286_10137608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 871 | Open in IMG/M |
| 3300031099|Ga0308181_1164761 | Not Available | 528 | Open in IMG/M |
| 3300031421|Ga0308194_10317388 | Not Available | 545 | Open in IMG/M |
| 3300031901|Ga0307406_10636359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 884 | Open in IMG/M |
| 3300031908|Ga0310900_11718272 | Not Available | 533 | Open in IMG/M |
| 3300032205|Ga0307472_100409113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1138 | Open in IMG/M |
| 3300033412|Ga0310810_10220135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2122 | Open in IMG/M |
| 3300033551|Ga0247830_11604517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.03% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.31% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.31% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Cyanobacterial | Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial | 0.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011244 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 18 - S13.2.60.3.a - transect 2, repeat 3, age 113 years, surface depth) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015064 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7B, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015069 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake | Environmental | Open in IMG/M |
| 3300015158 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin) | Environmental | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026863 | Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_05452981 | 3300000033 | Soil | MSKXMITFVLFXSGALXXPPRXLNXLGPXAAAIGWKIKNTLAYR* |
| INPhiseqgaiiFebDRAFT_1057754342 | 3300000364 | Soil | MSKLMIIFVLVMSGAIYDPPRVLNHLGPDAAAIGWKIKNALPYH* |
| C688J35102_1184153501 | 3300002568 | Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPHAAAIGWHIKTTFNLR* |
| soilL2_102201942 | 3300003319 | Sugarcane Root And Bulk Soil | MSKLMIVFVLLVSGSLYDPQRVIYQLGPEASAVGWKIASTLRLR* |
| Ga0062593_1027363171 | 3300004114 | Soil | MSKLMIVFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNAFAFR* |
| Ga0062589_1007030271 | 3300004156 | Soil | MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR* |
| Ga0062589_1020878342 | 3300004156 | Soil | MSKLMIIFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNAFAFR* |
| Ga0062591_1006831762 | 3300004643 | Soil | MSKLMILFVLLVSGSLYDPQRVIHQLGPEASAIGWKIASTLRMR* |
| Ga0062594_1017861821 | 3300005093 | Soil | PRSAMSKLMILFVLLVSGSLYDPQRVIHQLGPEASAIGWKIASTLRMR* |
| Ga0066673_102328312 | 3300005175 | Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFSFR* |
| Ga0066671_101920161 | 3300005184 | Soil | MSKLMILFVLFISGSLYDPPRVLSHLGPGAAALGWHIKTTFSLR* |
| Ga0070690_1000497453 | 3300005330 | Switchgrass Rhizosphere | MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR* |
| Ga0070677_100035931 | 3300005333 | Miscanthus Rhizosphere | MSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR* |
| Ga0070687_1006973082 | 3300005343 | Switchgrass Rhizosphere | MSKLMILFVLFVSGSLYDPPRVLNHLGPDAAALGWKIKNTLAYR* |
| Ga0070673_1011374911 | 3300005364 | Switchgrass Rhizosphere | MSKLMILFVLFISGSLYDPPRVLNHLGPGASAIGWHIKTAFAIR* |
| Ga0070701_103622872 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKLMILFVLFISGSLYDPPRVLNHLGPGASAIGWHIKTAFSFR* |
| Ga0070672_1011445091 | 3300005543 | Miscanthus Rhizosphere | MSKLMILFVLFISGSLYDPPRVLKHLGPGAAAIGWHIKTTFSLR* |
| Ga0070686_1012097222 | 3300005544 | Switchgrass Rhizosphere | MSKLMILFVLFISGTLYDPPRVLNHLGPGASAIGWHIKTTFAIR* |
| Ga0070665_1011284082 | 3300005548 | Switchgrass Rhizosphere | MSKFMILLFVFLAGSLYDPPRALSQLVGPEAAAMGWRIKTAFYR* |
| Ga0066670_104639982 | 3300005560 | Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTTFNFR* |
| Ga0066702_103212991 | 3300005575 | Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPGAAALGWHIKTAFSLR* |
| Ga0068857_1015910331 | 3300005577 | Corn Rhizosphere | MSKLMILFVLFISGSLYDPPRVLNHLGPGAAALGWHIKTAFNFR* |
| Ga0068861_1014302123 | 3300005719 | Switchgrass Rhizosphere | MSKLMIIFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNTFALR* |
| Ga0068860_1025198611 | 3300005843 | Switchgrass Rhizosphere | MSKLMILFVLLVSASLYDPQRVIQQLGPEASAIGWKIASTLR |
| Ga0068862_1021672162 | 3300005844 | Switchgrass Rhizosphere | MSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFNLR* |
| Ga0066660_111775811 | 3300006800 | Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTALAIR* |
| Ga0111539_108567161 | 3300009094 | Populus Rhizosphere | MSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR* |
| Ga0105247_103869252 | 3300009101 | Switchgrass Rhizosphere | MSKLMILFVLFISGSLYDPPRVLSHLGPGAAAIGWHIKTTFRLR* |
| Ga0066709_1024322222 | 3300009137 | Grasslands Soil | ISFVLFISGALYDPPRVLNQLGPSADAVGWHIKTAFRVR* |
| Ga0105243_104730012 | 3300009148 | Miscanthus Rhizosphere | MMEGTMSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFNFR* |
| Ga0111538_130389171 | 3300009156 | Populus Rhizosphere | MSKLMIIFVLFVSGAMYDPPRVLHQLGPEAASVGWKIASSL |
| Ga0105242_125775671 | 3300009176 | Miscanthus Rhizosphere | MSKLMILFVLFISGTLYDPPRVLNHRGPGAAAIGWHIKTAFSFR* |
| Ga0105238_101690582 | 3300009551 | Corn Rhizosphere | MSKLMILFVLLVSGSLYDPQRVMYQLGPEASAVGWKIASTLRLR* |
| Ga0105249_109135842 | 3300009553 | Switchgrass Rhizosphere | MSKLMVIFVLLMSGSLYDPQRVLGHLGPDAAAVAMKIKNTMPSFR* |
| Ga0126313_102228173 | 3300009840 | Serpentine Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPSFSSLGWHIKTTLNIR* |
| Ga0126315_108613522 | 3300010038 | Serpentine Soil | MSKLMILFVLFISGSLYDPPRVLNHLAPSFSSLGWHIKTTLNIR* |
| Ga0126309_100916543 | 3300010039 | Serpentine Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPHAAAIGWH |
| Ga0126309_107038751 | 3300010039 | Serpentine Soil | MSKLMILFVLFISGSLYDPPRVLSHLGDAQAIGWKIKATLGLR* |
| Ga0126311_100050392 | 3300010045 | Serpentine Soil | MILFVLFVSGSLYDPPRVLNHIGPQAAAIGSHIKSTFNLR* |
| Ga0126311_118853521 | 3300010045 | Serpentine Soil | MSKLVILFVLFISGSLYDPPPVLSHLGPQAAAIGWH |
| Ga0134063_106450101 | 3300010335 | Grasslands Soil | MSKLMVIFILFISGSLYDPPRVLNHLGSDAAAIGWKIKTTL |
| Ga0134127_102046883 | 3300010399 | Terrestrial Soil | MMEGTMSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFNLR* |
| Ga0134122_126126572 | 3300010400 | Terrestrial Soil | MSKLMILFILFISGSLYDPPRVLNHLGPGAAALGWHIKTTFNLR* |
| Ga0137483_10002753 | 3300011244 | Glacier Forefield Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAIGWHIKSTFGFR* |
| Ga0137382_108459791 | 3300012200 | Vadose Zone Soil | LMVIFILFVSGSLYDPPRLLNHLGPDAAAIGWKIKNTLHVR* |
| Ga0150985_1208180462 | 3300012212 | Avena Fatua Rhizosphere | MSKLMILFVLFISGSLYDPPRVLNHLGPGATALGWHIKTAFNFR* |
| Ga0157295_100115201 | 3300012906 | Soil | MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIAST |
| Ga0137395_110019292 | 3300012917 | Vadose Zone Soil | MSKLMVIFILFVSGSLYDPPRVLNHLGPDAAAIGWKIKNTLHVR* |
| Ga0137394_113665222 | 3300012922 | Vadose Zone Soil | MSKLMVIFILFVSGSLYDPPRLLNHLGPDAAAIGWKIKNTLHVR* |
| Ga0137419_105594422 | 3300012925 | Vadose Zone Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPQAAAIGWHIKT |
| Ga0137410_116298821 | 3300012944 | Vadose Zone Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAIGWHIKSTFNLR* |
| Ga0164308_118721631 | 3300012985 | Soil | MSKRMILFVLFISGSLYDPPRVLNHLGPGASAIGWHIKTAFSFR* |
| Ga0164304_110907111 | 3300012986 | Soil | MSKLMILFVLFISGTLYDTPRVLNHLGPGASAIGWHIKTTFAIR* |
| Ga0157378_115627832 | 3300013297 | Miscanthus Rhizosphere | MSKLMIVFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNTFALR* |
| Ga0163162_109205973 | 3300013306 | Switchgrass Rhizosphere | PRSAMSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR* |
| Ga0163163_132793621 | 3300014325 | Switchgrass Rhizosphere | MSKLMILFVLFISGSLYDPPRVLNHLGPGASAIGWHIK |
| Ga0157380_106157132 | 3300014326 | Switchgrass Rhizosphere | MSKLMIIFVLFVSGSLYDPSRVLNQLGPDAAAIGWKIKNAFAFR* |
| Ga0157380_108956432 | 3300014326 | Switchgrass Rhizosphere | MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTAFAIR* |
| Ga0157380_116560402 | 3300014326 | Switchgrass Rhizosphere | MSKLMIIFVLFVSGAMYDPPRVLHQLGPEVAAVGWKIASTLRSH* |
| Ga0157380_122159731 | 3300014326 | Switchgrass Rhizosphere | LMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTTFSLR* |
| Ga0157379_101672952 | 3300014968 | Switchgrass Rhizosphere | MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTTFSLR* |
| Ga0137405_13779654 | 3300015053 | Vadose Zone Soil | MMSKLMILFVLFISGSLYDPPRVLNHLGPGATAIGWHIKSTFNLR* |
| Ga0167641_1282831 | 3300015064 | Glacier Forefield Soil | MSKLMILFVLFVSGSLYDPPRVLNHLVPGATAIGWHIKSTFGLR* |
| Ga0167633_10048714 | 3300015069 | Glacier Forefield Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAIGWHIKSTFGLR* |
| Ga0167622_100014743 | 3300015158 | Glacier Forefield Soil | MMLFIFVMAGAIYDPPRALSHLSDVQAIGWKIKATLGVY* |
| Ga0167623_100018927 | 3300015161 | Glacier Forefield Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGASAIGWHIKSTFNFR* |
| Ga0173480_112538161 | 3300015200 | Soil | NRHQHRTWEARMSKLMIIFVLFVSGAIYDPPRVLHQLGPEVAAVGWKIASTLRSH* |
| Ga0137418_106398562 | 3300015241 | Vadose Zone Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPQAAAIGWHIKTSLGVR* |
| Ga0132255_1008996502 | 3300015374 | Arabidopsis Rhizosphere | MSKLMIVFVLLVSGSLYDPQRVIHQLGPEASAIGWKIASTLRMR* |
| Ga0132255_1019144451 | 3300015374 | Arabidopsis Rhizosphere | MSKLMILFVLFISGSLYDPPRVLNHLGPGASAIGWHIKTTFAIR* |
| Ga0184604_102790182 | 3300018000 | Groundwater Sediment | MSKLMILFVLFISGSLYDPPRVLNHLGPGATAIGWHIKSTFNLR |
| Ga0184617_10851302 | 3300018066 | Groundwater Sediment | MSKLMILFVLFISGSLYDPPRVLNHLGPGATAIGWHIKSTFGFR |
| Ga0184618_104426561 | 3300018071 | Groundwater Sediment | MSKLMILFVLFISGSLYDPPRVLNHLGPQAAAIGWHIKTSLGVR |
| Ga0184624_100091242 | 3300018073 | Groundwater Sediment | MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR |
| Ga0184628_106811692 | 3300018083 | Groundwater Sediment | MSKLMIVFDLFVSGAMYDPPRVLHQLGPEVAAVGWKIASTLRSH |
| Ga0190265_101325213 | 3300018422 | Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFNLR |
| Ga0190272_1000178612 | 3300018429 | Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAIGWHIKSTFNLR |
| Ga0066655_111163231 | 3300018431 | Grasslands Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPGAAALGWHIKTTFSLR |
| Ga0190275_101512793 | 3300018432 | Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGASAIGWHIKSTFNFR |
| Ga0066667_115911982 | 3300018433 | Grasslands Soil | MSKLMVIFILFISGSLYDPPRVLNHLGSDAAAIGWKIKTTLHIR |
| Ga0066662_103357942 | 3300018468 | Grasslands Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPGAAALGWHIKTAFSLR |
| Ga0066662_108754771 | 3300018468 | Grasslands Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTALAIR |
| Ga0190274_104093572 | 3300018476 | Soil | MSKLMIIFVLFVSGSLYDPPRLLNQLGPDAAAIGWKIASTLRSH |
| Ga0066669_106313391 | 3300018482 | Grasslands Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTTFNFR |
| Ga0066669_107889583 | 3300018482 | Grasslands Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFSFR |
| Ga0173479_100761002 | 3300019362 | Soil | MSKLMILFVLLVSGSLYDPQRVIHQLGPEASAIGWKIASTLRMR |
| Ga0190264_102302672 | 3300019377 | Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGASAIGWHIKSAFNLR |
| Ga0193725_10231241 | 3300019883 | Soil | MSKLMILFVLFVSGSLYDPPRVLNQLGPQAAAIGWHIKTALYR |
| Ga0193697_10091802 | 3300020005 | Soil | MSKLMIVFVLFISGSLYDPPRVLGQLGQLAQFGPEAAAVGSKIASTLLR |
| Ga0193696_10186522 | 3300020016 | Soil | MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR |
| Ga0193717_10160575 | 3300020060 | Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAVGWQIKSAFGFR |
| Ga0222622_105184411 | 3300022756 | Groundwater Sediment | LFVLLVSGSLYDPQRVIHQLGPEASAIGWKIASTLRMR |
| Ga0222622_107664411 | 3300022756 | Groundwater Sediment | MSKLMILFILFISGSLYDPPRVLNHIVGPEAAAIGWKIKSTFNLR |
| Ga0207697_103411281 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | LMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR |
| Ga0207682_100025652 | 3300025893 | Miscanthus Rhizosphere | MSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR |
| Ga0207688_100876981 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR |
| Ga0207662_102328222 | 3300025918 | Switchgrass Rhizosphere | MSKLMIVFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNTFALR |
| Ga0207659_110275692 | 3300025926 | Miscanthus Rhizosphere | MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKI |
| Ga0207686_110973172 | 3300025934 | Miscanthus Rhizosphere | MSKLMILFVLFISGTLYDPPRVLNHLGPGASAIGWHIKTTFAIR |
| Ga0207669_103503942 | 3300025937 | Miscanthus Rhizosphere | MSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASSLRMR |
| Ga0207689_117111202 | 3300025942 | Miscanthus Rhizosphere | MSKLMIIFVLFVSGSLYDPPRLLNQLGPDAAAIGWKIKTSLAFR |
| Ga0207679_117903101 | 3300025945 | Corn Rhizosphere | AMSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR |
| Ga0207675_1006081813 | 3300026118 | Switchgrass Rhizosphere | MSKLMIIFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNTFALR |
| Ga0209153_11225861 | 3300026312 | Soil | MSKLMILFVLFISGSLYDPPRVLSHLGPGAAALGWHIKTTFSLR |
| Ga0209902_1057594 | 3300026863 | Cyanobacterial | LLMSGALYDPPRVINHLGPQASAVGWQIASTLRMW |
| Ga0207428_112872501 | 3300027907 | Populus Rhizosphere | RSAMSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASSLRMR |
| Ga0268266_111184092 | 3300028379 | Switchgrass Rhizosphere | MSKFMILLFVFLAGSLYDPPRALSQLVGPEAAAMGWRIKTAFYR |
| Ga0265319_12273952 | 3300028563 | Rhizosphere | MSKLMILFVLFMSGTLYDPPRVLHSLAPELSALGWTIKTTLRVR |
| Ga0307286_101376081 | 3300028876 | Soil | SAMSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR |
| Ga0308181_11647611 | 3300031099 | Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAIGWHIKSTFGLR |
| Ga0308194_103173882 | 3300031421 | Soil | MSKLMVVFILFISGSLYDPPRVLNHLGPDAAAIGWKIKNTLHIR |
| Ga0307406_106363592 | 3300031901 | Rhizosphere | MMEGTLSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFNFR |
| Ga0310900_117182721 | 3300031908 | Soil | MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRM |
| Ga0307472_1004091132 | 3300032205 | Hardwood Forest Soil | MSKLMILFVLFISGSLYDPPRVLNHLGPAAAELGWHIKTAFNLR |
| Ga0310810_102201353 | 3300033412 | Soil | MSKLMILFVLFISGSLYDPPRVLSHLGPGAAAIGWHIKTTFRLR |
| Ga0247830_116045171 | 3300033551 | Soil | MSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTAFNFR |
| ⦗Top⦘ |