Metagenome / Metatranscriptome Family F078433

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F078433
Family Type	Metagenome / Metatranscriptome
Number of Sequences	116
Average Sequence Length	44 residues
Representative Sequence	MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTTFSLR
Number of Associated Samples	106
Number of Associated Scaffolds	116

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	84.96 %
% of genes near scaffold ends (potentially truncated)	20.69 %
% of genes from short scaffolds (< 2000 bps)	83.62 %
Associated GOLD sequencing projects	98
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (76.724 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.517 % of family members)
Environment Ontology (ENVO)	Unclassified (42.241 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.414 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.36
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 116 Family Scaffolds
PF12697	Abhydrolase_6	22.41
PF12973	Cupin_7	8.62
PF00561	Abhydrolase_1	8.62
PF08386	Abhydrolase_4	5.17
PF00501	AMP-binding	0.86
PF00994	MoCF_biosynth	0.86
PF00676	E1_dh	0.86
PF06233	Usg	0.86
PF00132	Hexapep	0.86
PF10722	YbjN	0.86
PF05175	MTS	0.86
PF05096	Glu_cyclase_2	0.86
PF00156	Pribosyltran	0.86

COG ID	Name	Functional Category	% Frequency in 116 Family Scaffolds
COG0567	2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes	Energy production and conversion [C]	0.86
COG1071	TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha	Energy production and conversion [C]	0.86
COG3823	Glutamine cyclotransferase	Posttranslational modification, protein turnover, chaperones [O]	0.86

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	76.72 %
Unclassified	root	N/A	23.28 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	76.72 %
Unclassified	root	N/A	23.28 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	76.72 %
Unclassified	root	N/A	23.28 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	73.28 %
Unclassified	root	N/A	23.28 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	72.41 %
Unclassified	root	N/A	23.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.28 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	16.38 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	13.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.28 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	15.52 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.86 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.86 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.86 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.28 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	15.52 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.86 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.86 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.86 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.28 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	15.52 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.86 %
unclassified Methylobacterium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium	0.86 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.86 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.28 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	15.52 %
Methylobacterium sp. 17Sr1-1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 17Sr1-1	0.86 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.86 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.86 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.86 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000033\|ICChiseqgaiiDRAFT_c0545298	Not Available	706	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_105775434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1002	Open in IMG/M
3300002568\|C688J35102_118415350	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300003319\|soilL2_10220194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1711	Open in IMG/M
3300004114\|Ga0062593_102736317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	562	Open in IMG/M
3300004156\|Ga0062589_100703027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	898	Open in IMG/M
3300004156\|Ga0062589_102087834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	577	Open in IMG/M
3300004643\|Ga0062591_100683176	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	925	Open in IMG/M
3300005093\|Ga0062594_101786182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	647	Open in IMG/M
3300005175\|Ga0066673_10232831	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1062	Open in IMG/M
3300005184\|Ga0066671_10192016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1222	Open in IMG/M
3300005330\|Ga0070690_100049745	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2673	Open in IMG/M
3300005333\|Ga0070677_10003593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5003	Open in IMG/M
3300005343\|Ga0070687_100697308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	709	Open in IMG/M
3300005364\|Ga0070673_101137491	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	730	Open in IMG/M
3300005438\|Ga0070701_10362287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	909	Open in IMG/M
3300005543\|Ga0070672_101144509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	692	Open in IMG/M
3300005544\|Ga0070686_101209722	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	628	Open in IMG/M
3300005560\|Ga0066670_10463998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	780	Open in IMG/M
3300005575\|Ga0066702_10321299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	943	Open in IMG/M
3300005577\|Ga0068857_101591033	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	638	Open in IMG/M
3300005719\|Ga0068861_101430212	Not Available	676	Open in IMG/M
3300005843\|Ga0068860_102519861	Not Available	534	Open in IMG/M
3300005844\|Ga0068862_102167216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	567	Open in IMG/M
3300006800\|Ga0066660_11177581	Not Available	603	Open in IMG/M
3300009094\|Ga0111539_10856716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1057	Open in IMG/M
3300009101\|Ga0105247_10386925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	993	Open in IMG/M
3300009148\|Ga0105243_10473001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1181	Open in IMG/M
3300009156\|Ga0111538_13038917	Not Available	586	Open in IMG/M
3300009176\|Ga0105242_12577567	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	557	Open in IMG/M
3300009551\|Ga0105238_10169058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2162	Open in IMG/M
3300009553\|Ga0105249_10913584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	945	Open in IMG/M
3300009840\|Ga0126313_10222817	All Organisms → cellular organisms → Bacteria → Proteobacteria	1454	Open in IMG/M
3300010038\|Ga0126315_10861352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	600	Open in IMG/M
3300010039\|Ga0126309_10091654	Not Available	1548	Open in IMG/M
3300010039\|Ga0126309_10703875	Not Available	649	Open in IMG/M
3300010045\|Ga0126311_10005039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6989	Open in IMG/M
3300010045\|Ga0126311_11885352	Not Available	508	Open in IMG/M
3300010335\|Ga0134063_10645010	Not Available	543	Open in IMG/M
3300010399\|Ga0134127_10204688	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1838	Open in IMG/M
3300010400\|Ga0134122_12612657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	556	Open in IMG/M
3300011244\|Ga0137483_100027	All Organisms → cellular organisms → Bacteria	119304	Open in IMG/M
3300012200\|Ga0137382_10845979	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	659	Open in IMG/M
3300012212\|Ga0150985_120818046	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	833	Open in IMG/M
3300012906\|Ga0157295_10011520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1584	Open in IMG/M
3300012917\|Ga0137395_11001929	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	598	Open in IMG/M
3300012922\|Ga0137394_11366522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	570	Open in IMG/M
3300012925\|Ga0137419_10559442	Not Available	914	Open in IMG/M
3300012944\|Ga0137410_11629882	Not Available	566	Open in IMG/M
3300012985\|Ga0164308_11872163	Not Available	559	Open in IMG/M
3300012986\|Ga0164304_11090711	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	638	Open in IMG/M
3300013297\|Ga0157378_11562783	Not Available	705	Open in IMG/M
3300013306\|Ga0163162_10920597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	987	Open in IMG/M
3300014325\|Ga0163163_13279362	Not Available	505	Open in IMG/M
3300014326\|Ga0157380_10615713	Not Available	1077	Open in IMG/M
3300014326\|Ga0157380_10895643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	913	Open in IMG/M
3300014326\|Ga0157380_11656040	Not Available	696	Open in IMG/M
3300014326\|Ga0157380_12215973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	613	Open in IMG/M
3300014968\|Ga0157379_10167295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1985	Open in IMG/M
3300015053\|Ga0137405_1377965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1821	Open in IMG/M
3300015064\|Ga0167641_128283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	501	Open in IMG/M
3300015069\|Ga0167633_100487	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	15110	Open in IMG/M
3300015158\|Ga0167622_1000147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	41849	Open in IMG/M
3300015161\|Ga0167623_1000189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	26920	Open in IMG/M
3300015200\|Ga0173480_11253816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 17Sr1-1	503	Open in IMG/M
3300015241\|Ga0137418_10639856	All Organisms → cellular organisms → Bacteria	828	Open in IMG/M
3300015374\|Ga0132255_100899650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1323	Open in IMG/M
3300015374\|Ga0132255_101914445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	902	Open in IMG/M
3300018000\|Ga0184604_10279018	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	588	Open in IMG/M
3300018066\|Ga0184617_1085130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	863	Open in IMG/M
3300018071\|Ga0184618_10442656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	547	Open in IMG/M
3300018073\|Ga0184624_10009124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3386	Open in IMG/M
3300018083\|Ga0184628_10681169	Not Available	514	Open in IMG/M
3300018422\|Ga0190265_10132521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2404	Open in IMG/M
3300018429\|Ga0190272_10001786	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10309	Open in IMG/M
3300018431\|Ga0066655_11116323	Not Available	553	Open in IMG/M
3300018432\|Ga0190275_10151279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2139	Open in IMG/M
3300018433\|Ga0066667_11591198	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300018468\|Ga0066662_10335794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1291	Open in IMG/M
3300018468\|Ga0066662_10875477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	879	Open in IMG/M
3300018476\|Ga0190274_10409357	Not Available	1319	Open in IMG/M
3300018482\|Ga0066669_10631339	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	941	Open in IMG/M
3300018482\|Ga0066669_10788958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	840	Open in IMG/M
3300019362\|Ga0173479_10076100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1179	Open in IMG/M
3300019377\|Ga0190264_10230267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1054	Open in IMG/M
3300019883\|Ga0193725_1023124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1689	Open in IMG/M
3300020005\|Ga0193697_1009180	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2411	Open in IMG/M
3300020016\|Ga0193696_1018652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1867	Open in IMG/M
3300020060\|Ga0193717_1016057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3355	Open in IMG/M
3300022756\|Ga0222622_10518441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	853	Open in IMG/M
3300022756\|Ga0222622_10766441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	704	Open in IMG/M
3300025315\|Ga0207697_10341128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	665	Open in IMG/M
3300025893\|Ga0207682_10002565	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	8112	Open in IMG/M
3300025901\|Ga0207688_10087698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1784	Open in IMG/M
3300025918\|Ga0207662_10232822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1204	Open in IMG/M
3300025926\|Ga0207659_11027569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	709	Open in IMG/M
3300025934\|Ga0207686_11097317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	649	Open in IMG/M
3300025937\|Ga0207669_10350394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1140	Open in IMG/M
3300025942\|Ga0207689_11711120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	521	Open in IMG/M
3300025945\|Ga0207679_11790310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	561	Open in IMG/M
3300026118\|Ga0207675_100608181	Not Available	1096	Open in IMG/M
3300026312\|Ga0209153_1122586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	984	Open in IMG/M
3300026863\|Ga0209902_105759	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1835	Open in IMG/M
3300027907\|Ga0207428_11287250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	507	Open in IMG/M
3300028563\|Ga0265319_1227395	Not Available	570	Open in IMG/M
3300028876\|Ga0307286_10137608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	871	Open in IMG/M
3300031099\|Ga0308181_1164761	Not Available	528	Open in IMG/M
3300031421\|Ga0308194_10317388	Not Available	545	Open in IMG/M
3300031901\|Ga0307406_10636359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	884	Open in IMG/M
3300031908\|Ga0310900_11718272	Not Available	533	Open in IMG/M
3300032205\|Ga0307472_100409113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1138	Open in IMG/M
3300033412\|Ga0310810_10220135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2122	Open in IMG/M
3300033551\|Ga0247830_11604517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	521	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	65.52%
Host-Associated	Host-Associated	34.48%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	59.48%
Plants	Host-Associated → Plants	33.62%
Aquatic	Environmental → Aquatic	6.03%
Microbial	Host-Associated → Microbial	0.86%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	59.48%
Rhizosphere	Host-Associated → Plants → Rhizosphere	22.41%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.34%
Sediment	Environmental → Aquatic → Sediment	6.03%
Bacteria	Host-Associated → Microbial → Bacteria	0.86%
Roots	Host-Associated → Plants → Roots	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	53.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.79%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.62%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.76%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.03%
Loam	Environmental → Terrestrial → Soil → Loam	6.03%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.59%
Unclassified	Host-Associated → Microbial → Bacteria → Unclassified	0.86%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	33.62%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.79%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	12.07%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.62%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.76%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.03%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.17%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.31%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.59%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.72%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.72%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.86%
Unclassified	Host-Associated → Microbial → Bacteria → Unclassified → Unclassified	0.86%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.86%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	15.52%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	6.03%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.03%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	6.03%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	5.17%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.31%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	4.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	4.31%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	4.31%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	4.31%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.45%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.59%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.59%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.72%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.72%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.72%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.72%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.72%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.86%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.86%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.86%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.86%
Cyanobacterial	Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial	0.86%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.86%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.86%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.86%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.86%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.86%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.86%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011244	Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 18 - S13.2.60.3.a - transect 2, repeat 3, age 113 years, surface depth)	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015053	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015064	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7B, Adjacent to main proglacial river, mid transect (Watson river))	Environmental	Open in IMG/M
3300015069	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake	Environmental	Open in IMG/M
3300015158	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin)	Environmental	Open in IMG/M
3300015161	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin)	Environmental	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300019883	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2	Environmental	Open in IMG/M
3300020005	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2	Environmental	Open in IMG/M
3300020016	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1	Environmental	Open in IMG/M
3300020060	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026312	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)	Environmental	Open in IMG/M
3300026863	Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Host-Associated	Open in IMG/M
3300028876	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140	Environmental	Open in IMG/M
3300031099	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031421	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiDRAFT_05452981	3300000033	Soil	MSKXMITFVLFXSGALXXPPRXLNXLGPXAAAIGWKIKNTLAYR*
INPhiseqgaiiFebDRAFT_1057754342	3300000364	Soil	MSKLMIIFVLVMSGAIYDPPRVLNHLGPDAAAIGWKIKNALPYH*
C688J35102_1184153501	3300002568	Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPHAAAIGWHIKTTFNLR*
soilL2_102201942	3300003319	Sugarcane Root And Bulk Soil	MSKLMIVFVLLVSGSLYDPQRVIYQLGPEASAVGWKIASTLRLR*
Ga0062593_1027363171	3300004114	Soil	MSKLMIVFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNAFAFR*
Ga0062589_1007030271	3300004156	Soil	MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR*
Ga0062589_1020878342	3300004156	Soil	MSKLMIIFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNAFAFR*
Ga0062591_1006831762	3300004643	Soil	MSKLMILFVLLVSGSLYDPQRVIHQLGPEASAIGWKIASTLRMR*
Ga0062594_1017861821	3300005093	Soil	PRSAMSKLMILFVLLVSGSLYDPQRVIHQLGPEASAIGWKIASTLRMR*
Ga0066673_102328312	3300005175	Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFSFR*
Ga0066671_101920161	3300005184	Soil	MSKLMILFVLFISGSLYDPPRVLSHLGPGAAALGWHIKTTFSLR*
Ga0070690_1000497453	3300005330	Switchgrass Rhizosphere	MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR*
Ga0070677_100035931	3300005333	Miscanthus Rhizosphere	MSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR*
Ga0070687_1006973082	3300005343	Switchgrass Rhizosphere	MSKLMILFVLFVSGSLYDPPRVLNHLGPDAAALGWKIKNTLAYR*
Ga0070673_1011374911	3300005364	Switchgrass Rhizosphere	MSKLMILFVLFISGSLYDPPRVLNHLGPGASAIGWHIKTAFAIR*
Ga0070701_103622872	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	MSKLMILFVLFISGSLYDPPRVLNHLGPGASAIGWHIKTAFSFR*
Ga0070672_1011445091	3300005543	Miscanthus Rhizosphere	MSKLMILFVLFISGSLYDPPRVLKHLGPGAAAIGWHIKTTFSLR*
Ga0070686_1012097222	3300005544	Switchgrass Rhizosphere	MSKLMILFVLFISGTLYDPPRVLNHLGPGASAIGWHIKTTFAIR*
Ga0070665_1011284082	3300005548	Switchgrass Rhizosphere	MSKFMILLFVFLAGSLYDPPRALSQLVGPEAAAMGWRIKTAFYR*
Ga0066670_104639982	3300005560	Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTTFNFR*
Ga0066702_103212991	3300005575	Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPGAAALGWHIKTAFSLR*
Ga0068857_1015910331	3300005577	Corn Rhizosphere	MSKLMILFVLFISGSLYDPPRVLNHLGPGAAALGWHIKTAFNFR*
Ga0068861_1014302123	3300005719	Switchgrass Rhizosphere	MSKLMIIFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNTFALR*
Ga0068860_1025198611	3300005843	Switchgrass Rhizosphere	MSKLMILFVLLVSASLYDPQRVIQQLGPEASAIGWKIASTLR
Ga0068862_1021672162	3300005844	Switchgrass Rhizosphere	MSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFNLR*
Ga0066660_111775811	3300006800	Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTALAIR*
Ga0111539_108567161	3300009094	Populus Rhizosphere	MSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR*
Ga0105247_103869252	3300009101	Switchgrass Rhizosphere	MSKLMILFVLFISGSLYDPPRVLSHLGPGAAAIGWHIKTTFRLR*
Ga0066709_1024322222	3300009137	Grasslands Soil	ISFVLFISGALYDPPRVLNQLGPSADAVGWHIKTAFRVR*
Ga0105243_104730012	3300009148	Miscanthus Rhizosphere	MMEGTMSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFNFR*
Ga0111538_130389171	3300009156	Populus Rhizosphere	MSKLMIIFVLFVSGAMYDPPRVLHQLGPEAASVGWKIASSL
Ga0105242_125775671	3300009176	Miscanthus Rhizosphere	MSKLMILFVLFISGTLYDPPRVLNHRGPGAAAIGWHIKTAFSFR*
Ga0105238_101690582	3300009551	Corn Rhizosphere	MSKLMILFVLLVSGSLYDPQRVMYQLGPEASAVGWKIASTLRLR*
Ga0105249_109135842	3300009553	Switchgrass Rhizosphere	MSKLMVIFVLLMSGSLYDPQRVLGHLGPDAAAVAMKIKNTMPSFR*
Ga0126313_102228173	3300009840	Serpentine Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPSFSSLGWHIKTTLNIR*
Ga0126315_108613522	3300010038	Serpentine Soil	MSKLMILFVLFISGSLYDPPRVLNHLAPSFSSLGWHIKTTLNIR*
Ga0126309_100916543	3300010039	Serpentine Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPHAAAIGWH
Ga0126309_107038751	3300010039	Serpentine Soil	MSKLMILFVLFISGSLYDPPRVLSHLGDAQAIGWKIKATLGLR*
Ga0126311_100050392	3300010045	Serpentine Soil	MILFVLFVSGSLYDPPRVLNHIGPQAAAIGSHIKSTFNLR*
Ga0126311_118853521	3300010045	Serpentine Soil	MSKLVILFVLFISGSLYDPPPVLSHLGPQAAAIGWH
Ga0134063_106450101	3300010335	Grasslands Soil	MSKLMVIFILFISGSLYDPPRVLNHLGSDAAAIGWKIKTTL
Ga0134127_102046883	3300010399	Terrestrial Soil	MMEGTMSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFNLR*
Ga0134122_126126572	3300010400	Terrestrial Soil	MSKLMILFILFISGSLYDPPRVLNHLGPGAAALGWHIKTTFNLR*
Ga0137483_10002753	3300011244	Glacier Forefield Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAIGWHIKSTFGFR*
Ga0137382_108459791	3300012200	Vadose Zone Soil	LMVIFILFVSGSLYDPPRLLNHLGPDAAAIGWKIKNTLHVR*
Ga0150985_1208180462	3300012212	Avena Fatua Rhizosphere	MSKLMILFVLFISGSLYDPPRVLNHLGPGATALGWHIKTAFNFR*
Ga0157295_100115201	3300012906	Soil	MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIAST
Ga0137395_110019292	3300012917	Vadose Zone Soil	MSKLMVIFILFVSGSLYDPPRVLNHLGPDAAAIGWKIKNTLHVR*
Ga0137394_113665222	3300012922	Vadose Zone Soil	MSKLMVIFILFVSGSLYDPPRLLNHLGPDAAAIGWKIKNTLHVR*
Ga0137419_105594422	3300012925	Vadose Zone Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPQAAAIGWHIKT
Ga0137410_116298821	3300012944	Vadose Zone Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAIGWHIKSTFNLR*
Ga0164308_118721631	3300012985	Soil	MSKRMILFVLFISGSLYDPPRVLNHLGPGASAIGWHIKTAFSFR*
Ga0164304_110907111	3300012986	Soil	MSKLMILFVLFISGTLYDTPRVLNHLGPGASAIGWHIKTTFAIR*
Ga0157378_115627832	3300013297	Miscanthus Rhizosphere	MSKLMIVFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNTFALR*
Ga0163162_109205973	3300013306	Switchgrass Rhizosphere	PRSAMSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR*
Ga0163163_132793621	3300014325	Switchgrass Rhizosphere	MSKLMILFVLFISGSLYDPPRVLNHLGPGASAIGWHIK
Ga0157380_106157132	3300014326	Switchgrass Rhizosphere	MSKLMIIFVLFVSGSLYDPSRVLNQLGPDAAAIGWKIKNAFAFR*
Ga0157380_108956432	3300014326	Switchgrass Rhizosphere	MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTAFAIR*
Ga0157380_116560402	3300014326	Switchgrass Rhizosphere	MSKLMIIFVLFVSGAMYDPPRVLHQLGPEVAAVGWKIASTLRSH*
Ga0157380_122159731	3300014326	Switchgrass Rhizosphere	LMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTTFSLR*
Ga0157379_101672952	3300014968	Switchgrass Rhizosphere	MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTTFSLR*
Ga0137405_13779654	3300015053	Vadose Zone Soil	MMSKLMILFVLFISGSLYDPPRVLNHLGPGATAIGWHIKSTFNLR*
Ga0167641_1282831	3300015064	Glacier Forefield Soil	MSKLMILFVLFVSGSLYDPPRVLNHLVPGATAIGWHIKSTFGLR*
Ga0167633_10048714	3300015069	Glacier Forefield Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAIGWHIKSTFGLR*
Ga0167622_100014743	3300015158	Glacier Forefield Soil	MMLFIFVMAGAIYDPPRALSHLSDVQAIGWKIKATLGVY*
Ga0167623_100018927	3300015161	Glacier Forefield Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGASAIGWHIKSTFNFR*
Ga0173480_112538161	3300015200	Soil	NRHQHRTWEARMSKLMIIFVLFVSGAIYDPPRVLHQLGPEVAAVGWKIASTLRSH*
Ga0137418_106398562	3300015241	Vadose Zone Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPQAAAIGWHIKTSLGVR*
Ga0132255_1008996502	3300015374	Arabidopsis Rhizosphere	MSKLMIVFVLLVSGSLYDPQRVIHQLGPEASAIGWKIASTLRMR*
Ga0132255_1019144451	3300015374	Arabidopsis Rhizosphere	MSKLMILFVLFISGSLYDPPRVLNHLGPGASAIGWHIKTTFAIR*
Ga0184604_102790182	3300018000	Groundwater Sediment	MSKLMILFVLFISGSLYDPPRVLNHLGPGATAIGWHIKSTFNLR
Ga0184617_10851302	3300018066	Groundwater Sediment	MSKLMILFVLFISGSLYDPPRVLNHLGPGATAIGWHIKSTFGFR
Ga0184618_104426561	3300018071	Groundwater Sediment	MSKLMILFVLFISGSLYDPPRVLNHLGPQAAAIGWHIKTSLGVR
Ga0184624_100091242	3300018073	Groundwater Sediment	MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR
Ga0184628_106811692	3300018083	Groundwater Sediment	MSKLMIVFDLFVSGAMYDPPRVLHQLGPEVAAVGWKIASTLRSH
Ga0190265_101325213	3300018422	Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFNLR
Ga0190272_1000178612	3300018429	Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAIGWHIKSTFNLR
Ga0066655_111163231	3300018431	Grasslands Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPGAAALGWHIKTTFSLR
Ga0190275_101512793	3300018432	Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGASAIGWHIKSTFNFR
Ga0066667_115911982	3300018433	Grasslands Soil	MSKLMVIFILFISGSLYDPPRVLNHLGSDAAAIGWKIKTTLHIR
Ga0066662_103357942	3300018468	Grasslands Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPGAAALGWHIKTAFSLR
Ga0066662_108754771	3300018468	Grasslands Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTALAIR
Ga0190274_104093572	3300018476	Soil	MSKLMIIFVLFVSGSLYDPPRLLNQLGPDAAAIGWKIASTLRSH
Ga0066669_106313391	3300018482	Grasslands Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPGAAAIGWHIKTTFNFR
Ga0066669_107889583	3300018482	Grasslands Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFSFR
Ga0173479_100761002	3300019362	Soil	MSKLMILFVLLVSGSLYDPQRVIHQLGPEASAIGWKIASTLRMR
Ga0190264_102302672	3300019377	Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGASAIGWHIKSAFNLR
Ga0193725_10231241	3300019883	Soil	MSKLMILFVLFVSGSLYDPPRVLNQLGPQAAAIGWHIKTALYR
Ga0193697_10091802	3300020005	Soil	MSKLMIVFVLFISGSLYDPPRVLGQLGQLAQFGPEAAAVGSKIASTLLR
Ga0193696_10186522	3300020016	Soil	MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR
Ga0193717_10160575	3300020060	Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAVGWQIKSAFGFR
Ga0222622_105184411	3300022756	Groundwater Sediment	LFVLLVSGSLYDPQRVIHQLGPEASAIGWKIASTLRMR
Ga0222622_107664411	3300022756	Groundwater Sediment	MSKLMILFILFISGSLYDPPRVLNHIVGPEAAAIGWKIKSTFNLR
Ga0207697_103411281	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	LMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR
Ga0207682_100025652	3300025893	Miscanthus Rhizosphere	MSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR
Ga0207688_100876981	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR
Ga0207662_102328222	3300025918	Switchgrass Rhizosphere	MSKLMIVFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNTFALR
Ga0207659_110275692	3300025926	Miscanthus Rhizosphere	MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKI
Ga0207686_110973172	3300025934	Miscanthus Rhizosphere	MSKLMILFVLFISGTLYDPPRVLNHLGPGASAIGWHIKTTFAIR
Ga0207669_103503942	3300025937	Miscanthus Rhizosphere	MSKLMIVFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASSLRMR
Ga0207689_117111202	3300025942	Miscanthus Rhizosphere	MSKLMIIFVLFVSGSLYDPPRLLNQLGPDAAAIGWKIKTSLAFR
Ga0207679_117903101	3300025945	Corn Rhizosphere	AMSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRMR
Ga0207675_1006081813	3300026118	Switchgrass Rhizosphere	MSKLMIIFVLFVSGSLYDPPRVLNQLGPDAAAIGWKIKNTFALR
Ga0209153_11225861	3300026312	Soil	MSKLMILFVLFISGSLYDPPRVLSHLGPGAAALGWHIKTTFSLR
Ga0209902_1057594	3300026863	Cyanobacterial	LLMSGALYDPPRVINHLGPQASAVGWQIASTLRMW
Ga0207428_112872501	3300027907	Populus Rhizosphere	RSAMSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASSLRMR
Ga0268266_111184092	3300028379	Switchgrass Rhizosphere	MSKFMILLFVFLAGSLYDPPRALSQLVGPEAAAMGWRIKTAFYR
Ga0265319_12273952	3300028563	Rhizosphere	MSKLMILFVLFMSGTLYDPPRVLHSLAPELSALGWTIKTTLRVR
Ga0307286_101376081	3300028876	Soil	SAMSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRIR
Ga0308181_11647611	3300031099	Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGATAIGWHIKSTFGLR
Ga0308194_103173882	3300031421	Soil	MSKLMVVFILFISGSLYDPPRVLNHLGPDAAAIGWKIKNTLHIR
Ga0307406_106363592	3300031901	Rhizosphere	MMEGTLSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTTFNFR
Ga0310900_117182721	3300031908	Soil	MSKLMILFVLLVSGSLYDPQRVIQQLGPEASAIGWKIASTLRM
Ga0307472_1004091132	3300032205	Hardwood Forest Soil	MSKLMILFVLFISGSLYDPPRVLNHLGPAAAELGWHIKTAFNLR
Ga0310810_102201353	3300033412	Soil	MSKLMILFVLFISGSLYDPPRVLSHLGPGAAAIGWHIKTTFRLR
Ga0247830_116045171	3300033551	Soil	MSKLMILFVLFVSGSLYDPPRVLNHLGPGAAALGWHIKTAFNFR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F078433

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences