Metagenome / Metatranscriptome Family F008003

Overview

Basic Information

• Family ID: F008003
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 341
• Average Sequence Length: 39 residues
• Representative Sequence: MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIML
• Number of Associated Samples: 208
• Number of Associated Scaffolds: 341

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 22.92 %
• % of genes near scaffold ends (potentially truncated): 44.87 %
• % of genes from short scaffolds (< 2000 bps): 86.80 %
• Associated GOLD sequencing projects: 193
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (73.900 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.437 % of family members)
• Environment Ontology (ENVO): Unclassified (27.273 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (49.560 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 16.92%
  β-sheet: 0.00%
  Coil/Unstructured: 83.08%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 341 Family Scaffolds
PF03401	TctC	2.05
PF00528	BPD_transp_1	1.76
PF07221	GlcNAc_2-epim	1.47
PF02653	BPD_transp_2	1.47
PF14224	DUF4331	1.17
PF02683	DsbD	1.17
PF00005	ABC_tran	0.88
PF00370	FGGY_N	0.88
PF00550	PP-binding	0.88
PF12399	BCA_ABC_TP_C	0.88
PF04955	HupE_UreJ	0.88
PF08808	RES	0.88
PF13458	Peripla_BP_6	0.88
PF01578	Cytochrom_C_asm	0.88
PF01063	Aminotran_4	0.59
PF03480	DctP	0.59
PF01494	FAD_binding_3	0.59
PF00009	GTP_EFTU	0.59
PF01370	Epimerase	0.59
PF00497	SBP_bac_3	0.59
PF00571	CBS	0.59
PF00696	AA_kinase	0.59
PF01713	Smr	0.59
PF00557	Peptidase_M24	0.59
PF04828	GFA	0.59
PF12697	Abhydrolase_6	0.59
PF14588	YjgF_endoribonc	0.59
PF00293	NUDIX	0.59
PF00583	Acetyltransf_1	0.59
PF00903	Glyoxalase	0.59
PF00486	Trans_reg_C	0.59
PF13467	RHH_4	0.59
PF07883	Cupin_2	0.59
PF07690	MFS_1	0.59
PF00033	Cytochrome_B	0.59
PF01734	Patatin	0.59
PF01609	DDE_Tnp_1	0.59
PF08402	TOBE_2	0.59
PF02913	FAD-oxidase_C	0.59
PF03734	YkuD	0.59
PF01925	TauE	0.29
PF01796	OB_aCoA_assoc	0.29
PF05193	Peptidase_M16_C	0.29
PF00501	AMP-binding	0.29
PF01436	NHL	0.29
PF09334	tRNA-synt_1g	0.29
PF13953	PapC_C	0.29
PF05683	Fumerase_C	0.29
PF01019	G_glu_transpept	0.29
PF02699	YajC	0.29
PF01636	APH	0.29
PF00156	Pribosyltran	0.29
PF01522	Polysacc_deac_1	0.29
PF02771	Acyl-CoA_dh_N	0.29
PF13545	HTH_Crp_2	0.29
PF01262	AlaDh_PNT_C	0.29
PF01909	NTP_transf_2	0.29
PF01149	Fapy_DNA_glyco	0.29
PF00939	Na_sulph_symp	0.29
PF01970	TctA	0.29
PF00762	Ferrochelatase	0.29
PF11794	HpaB_N	0.29
PF01678	DAP_epimerase	0.29
PF01053	Cys_Met_Meta_PP	0.29
PF00691	OmpA	0.29
PF13147	Obsolete Pfam Family	0.29
PF01266	DAO	0.29
PF00857	Isochorismatase	0.29
PF04976	DmsC	0.29
PF13249	SQHop_cyclase_N	0.29
PF00709	Adenylsucc_synt	0.29
PF01728	FtsJ	0.29
PF13193	AMP-binding_C	0.29
PF14310	Fn3-like	0.29
PF01425	Amidase	0.29
PF04963	Sigma54_CBD	0.29
PF03358	FMN_red	0.29
PF00587	tRNA-synt_2b	0.29
PF02558	ApbA	0.29
PF00381	PTS-HPr	0.29
PF00364	Biotin_lipoyl	0.29
PF13662	Toprim_4	0.29
PF13847	Methyltransf_31	0.29
PF12096	DUF3572	0.29
PF02878	PGM_PMM_I	0.29
PF04055	Radical_SAM	0.29
PF01656	CbiA	0.29
PF00535	Glycos_transf_2	0.29
PF13532	2OG-FeII_Oxy_2	0.29
PF00011	HSP20	0.29
PF02541	Ppx-GppA	0.29
PF11799	IMS_C	0.29
PF09312	SurA_N	0.29
PF05731	TROVE	0.29
PF01926	MMR_HSR1	0.29
PF12098	DUF3574	0.29
PF07995	GSDH	0.29
PF04964	Flp_Fap	0.29
PF00313	CSD	0.29
PF02749	QRPTase_N	0.29
PF13641	Glyco_tranf_2_3	0.29
PF07021	MetW	0.29
PF04339	FemAB_like	0.29
PF02082	Rrf2	0.29
PF00462	Glutaredoxin	0.29
PF12704	MacB_PCD	0.29
PF01783	Ribosomal_L32p	0.29
PF13807	GNVR	0.29
PF03960	ArsC	0.29
PF02686	Glu-tRNAGln	0.29
PF02569	Pantoate_ligase	0.29
PF09285	Elong-fact-P_C	0.29
PF02515	CoA_transf_3	0.29
PF07977	FabA	0.29
PF04377	ATE_C	0.29
PF05118	Asp_Arg_Hydrox	0.29
PF12200	DUF3597	0.29
PF00719	Pyrophosphatase	0.29
PF02211	NHase_beta	0.29
PF00120	Gln-synt_C	0.29
PF00456	Transketolase_N	0.29
PF13432	TPR_16	0.29
PF01564	Spermine_synth	0.29
PF07372	DUF1491	0.29
PF00275	EPSP_synthase	0.29
PF01041	DegT_DnrJ_EryC1	0.29
PF03167	UDG	0.29
PF01738	DLH	0.29
PF03454	MoeA_C	0.29
PF01322	Cytochrom_C_2	0.29
PF04107	GCS2	0.29
PF05050	Methyltransf_21	0.29
PF14579	HHH_6	0.29
PF02954	HTH_8	0.29
PF00180	Iso_dh	0.29
PF00749	tRNA-synt_1c	0.29
PF03631	Virul_fac_BrkB	0.29
PF00330	Aconitase	0.29
PF04126	Cyclophil_like	0.29
PF07309	FlaF	0.29
PF13649	Methyltransf_25	0.29
PF01503	PRA-PH	0.29
PF02230	Abhydrolase_2	0.29
PF00753	Lactamase_B	0.29
PF03602	Cons_hypoth95	0.29
PF01192	RNA_pol_Rpb6	0.29
PF01988	VIT1	0.29
PF04073	tRNA_edit	0.29
PF01070	FMN_dh	0.29
PF03306	AAL_decarboxy	0.29
PF13577	SnoaL_4	0.29
PF00977	His_biosynth	0.29
PF14087	DUF4267	0.29
PF12833	HTH_18	0.29
PF00543	P-II	0.29
PF03711	OKR_DC_1_C	0.29
PF06155	GBBH-like_N	0.29
PF04390	LptE	0.29
PF00861	Ribosomal_L18p	0.29
PF01144	CoA_trans	0.29
PF01321	Creatinase_N	0.29
PF07100	ASRT	0.29
PF00496	SBP_bac_5	0.29
PF00534	Glycos_transf_1	0.29
PF00793	DAHP_synth_1	0.29
PF05598	DUF772	0.29
PF01710	HTH_Tnp_IS630	0.29
PF00892	EamA	0.29
PF09084	NMT1	0.29
PF09722	Xre_MbcA_ParS_C	0.29
PF02826	2-Hacid_dh_C	0.29
PF05974	DUF892	0.29
PF00160	Pro_isomerase	0.29
PF00664	ABC_membrane	0.29
PF03328	HpcH_HpaI	0.29
PF00296	Bac_luciferase	0.29
PF14748	P5CR_dimer	0.29
PF12002	MgsA_C	0.29
PF03453	MoeA_N	0.29
PF01025	GrpE	0.29
PF03379	CcmB	0.29
PF03330	DPBB_1	0.29
PF07813	LTXXQ	0.29
PF00361	Proton_antipo_M	0.29
PF01812	5-FTHF_cyc-lig	0.29
PF13434	Lys_Orn_oxgnase	0.29
PF00132	Hexapep	0.29
PF07366	SnoaL	0.29
PF01583	APS_kinase	0.29
PF03466	LysR_substrate	0.29

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 341 Family Scaffolds
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	2.05
COG2942	Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family	Carbohydrate transport and metabolism [G]	1.47
COG0115	Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase	Amino acid transport and metabolism [E]	1.17
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.17
COG3678	Periplasmic chaperone Spy, Spy/CpxP family	Posttranslational modification, protein turnover, chaperones [O]	1.17
COG2370	Hydrogenase/urease accessory protein HupE	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG5654	Predicted toxin component of a toxin-antitoxin system, contains RES domain	Defense mechanisms [V]	0.88
COG0248	Exopolyphosphatase/pppGpp-phosphohydrolase	Signal transduction mechanisms [T]	0.59
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.59
COG0303	Molybdopterin Mo-transferase (molybdopterin biosynthesis)	Coenzyme transport and metabolism [H]	0.59
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	0.59
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	0.59
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	0.59
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.59
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	0.59
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.59
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.59
COG1290	Cytochrome b subunit of the bc complex	Energy production and conversion [C]	0.59
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.59
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	0.59
COG1982	Arginine/lysine/ornithine decarboxylase	Amino acid transport and metabolism [E]	0.59
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	0.59
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.59
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.59
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.59
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.59
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	0.59
COG3791	Uncharacterized conserved protein	Function unknown [S]	0.59
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	0.59
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.59
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.59
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.59
COG0006	Xaa-Pro aminopeptidase	Amino acid transport and metabolism [E]	0.29
COG0008	Glutamyl- or glutaminyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.29
COG0018	Arginyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.29
COG0021	Transketolase	Carbohydrate transport and metabolism [G]	0.29
COG0033	Phosphoglucomutase/phosphomannomutase	Carbohydrate transport and metabolism [G]	0.29
COG0060	Isoleucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.29
COG0069	Glutamate synthase domain 2	Amino acid transport and metabolism [E]	0.29
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.29
COG0075	Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG	Amino acid transport and metabolism [E]	0.29
COG0104	Adenylosuccinate synthase	Nucleotide transport and metabolism [F]	0.29
COG0143	Methionyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.29
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.29
COG0156	7-keto-8-aminopelargonate synthetase or related enzyme	Coenzyme transport and metabolism [H]	0.29
COG0157	Nicotinate-nucleotide pyrophosphorylase	Coenzyme transport and metabolism [H]	0.29
COG0212	5-formyltetrahydrofolate cyclo-ligase	Coenzyme transport and metabolism [H]	0.29
COG0215	Cysteinyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.29
COG0221	Inorganic pyrophosphatase	Energy production and conversion [C]	0.29
COG0253	Diaminopimelate epimerase	Amino acid transport and metabolism [E]	0.29
COG0256	Ribosomal protein L18	Translation, ribosomal structure and biogenesis [J]	0.29
COG0266	Formamidopyrimidine-DNA glycosylase	Replication, recombination and repair [L]	0.29
COG0276	Protoheme ferro-lyase (ferrochelatase)	Coenzyme transport and metabolism [H]	0.29
COG0293	23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ	Translation, ribosomal structure and biogenesis [J]	0.29
COG0333	Ribosomal protein L32	Translation, ribosomal structure and biogenesis [J]	0.29
COG0347	Nitrogen regulatory protein PII	Signal transduction mechanisms [T]	0.29
COG0405	Gamma-glutamyltranspeptidase	Amino acid transport and metabolism [E]	0.29
COG0414	Panthothenate synthetase	Coenzyme transport and metabolism [H]	0.29
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.29
COG0471	Di- and tricarboxylate antiporter	Carbohydrate transport and metabolism [G]	0.29
COG0495	Leucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.29
COG0525	Valyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.29
COG0529	Adenylylsulfate kinase or related kinase	Inorganic ion transport and metabolism [P]	0.29
COG0576	Molecular chaperone GrpE (heat shock protein HSP-70)	Posttranslational modification, protein turnover, chaperones [O]	0.29
COG0640	DNA-binding transcriptional regulator, ArsR family	Transcription [K]	0.29
COG0652	Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family	Posttranslational modification, protein turnover, chaperones [O]	0.29
COG0692	Uracil-DNA glycosylase	Replication, recombination and repair [L]	0.29
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.29
COG0721	Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit	Translation, ribosomal structure and biogenesis [J]	0.29
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.29
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.29
COG0742	16S rRNA G966 N2-methylase RsmD	Translation, ribosomal structure and biogenesis [J]	0.29
COG0760	Peptidyl-prolyl isomerase, parvulin family	Posttranslational modification, protein turnover, chaperones [O]	0.29
COG0764	3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase	Lipid transport and metabolism [I]	0.29
COG1055	Na+/H+ antiporter NhaD or related arsenite permease	Inorganic ion transport and metabolism [P]	0.29
COG1092	23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI	Translation, ribosomal structure and biogenesis [J]	0.29
COG1104	Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family	Amino acid transport and metabolism [E]	0.29
COG1109	Phosphomannomutase	Carbohydrate transport and metabolism [G]	0.29
COG1189	Predicted rRNA methylase YqxC, contains S4 and FtsJ domains	Translation, ribosomal structure and biogenesis [J]	0.29
COG1295	Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)	Function unknown [S]	0.29
COG1304	FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase	Energy production and conversion [C]	0.29
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.29
COG1393	Arsenate reductase or related protein, glutaredoxin family	Inorganic ion transport and metabolism [P]	0.29
COG1414	DNA-binding transcriptional regulator, IclR family	Transcription [K]	0.29
COG1488	Nicotinic acid phosphoribosyltransferase	Coenzyme transport and metabolism [H]	0.29
COG1508	DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog	Transcription [K]	0.29
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.29
COG1545	Uncharacterized OB-fold protein, contains Zn-ribbon domain	General function prediction only [R]	0.29
COG1573	Uracil-DNA glycosylase	Replication, recombination and repair [L]	0.29
COG1633	Rubrerythrin, includes spore coat protein YhjR	Inorganic ion transport and metabolism [P]	0.29
COG1725	DNA-binding transcriptional regulator YhcF, GntR family	Transcription [K]	0.29
COG1758	DNA-directed RNA polymerase, subunit K/omega	Transcription [K]	0.29
COG1784	TctA family transporter	General function prediction only [R]	0.29
COG1788	Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit	Lipid transport and metabolism [I]	0.29
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.29
COG1814	Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family	Inorganic ion transport and metabolism [P]	0.29
COG1838	Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain	Energy production and conversion [C]	0.29
COG1862	Protein translocase subunit YajC	Intracellular trafficking, secretion, and vesicular transport [U]	0.29
COG1921	Seryl-tRNA(Sec) selenium transferase	Translation, ribosomal structure and biogenesis [J]	0.29
COG1925	HPr or related phosphotransfer protein	Signal transduction mechanisms [T]	0.29
COG1959	DNA-binding transcriptional regulator, IscR family	Transcription [K]	0.29
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.29
COG2008	Threonine aldolase	Amino acid transport and metabolism [E]	0.29
COG2057	Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit	Lipid transport and metabolism [I]	0.29
COG2133	Glucose/arabinose dehydrogenase, beta-propeller fold	Carbohydrate transport and metabolism [G]	0.29
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.29
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	0.29
COG2188	DNA-binding transcriptional regulator, GntR family	Transcription [K]	0.29
COG2242	Precorrin-6B methylase 2	Coenzyme transport and metabolism [H]	0.29
COG2265	tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family	Translation, ribosomal structure and biogenesis [J]	0.29
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.29
COG2378	Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains	Transcription [K]	0.29
COG2386	ABC-type transport system involved in cytochrome c biogenesis, permease component	Posttranslational modification, protein turnover, chaperones [O]	0.29
COG2524	Predicted transcriptional regulator, contains C-terminal CBS domains	Transcription [K]	0.29
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	0.29
COG2935	Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferase	Posttranslational modification, protein turnover, chaperones [O]	0.29
COG2980	Outer membrane lipoprotein LptE/RlpB (LPS assembly)	Cell wall/membrane/envelope biogenesis [M]	0.29
COG3146	Predicted N-acyltransferase	General function prediction only [R]	0.29
COG3302	DMSO reductase anchor subunit DmsC	Energy production and conversion [C]	0.29
COG3333	TctA family transporter	General function prediction only [R]	0.29
COG3415	CRISPR-associated protein Csa3, CARF domain	Defense mechanisms [V]	0.29
COG3527	Alpha-acetolactate decarboxylase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.29
COG3536	Uncharacterized conserved protein, DUF971 family	Function unknown [S]	0.29
COG3555	Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily	Posttranslational modification, protein turnover, chaperones [O]	0.29
COG3663	G:T/U-mismatch repair DNA glycosylase	Replication, recombination and repair [L]	0.29
COG3685	Ferritin-like metal-binding protein YciE	Inorganic ion transport and metabolism [P]	0.29
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.29
COG3847	Flp pilus assembly protein, pilin Flp	Extracellular structures [W]	0.29
COG3909	Cytochrome c556	Energy production and conversion [C]	0.29
COG3959	Transketolase, N-terminal subunit	Carbohydrate transport and metabolism [G]	0.29
COG4100	Cystathionine beta-lyase family protein involved in aluminum resistance	Inorganic ion transport and metabolism [P]	0.29
COG4288	Uncharacterized conserved protein	Function unknown [S]	0.29
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.29
COG4670	Acyl CoA:acetate/3-ketoacid CoA transferase	Lipid transport and metabolism [I]	0.29
COG4706	Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domain	Lipid transport and metabolism [I]	0.29
COG5442	Flagellar biosynthesis regulator FlaF	Cell motility [N]	0.29
COG5447	Uncharacterized conserved protein, DUF1491 domain	Function unknown [S]	0.29

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	74.19 %
Unclassified	root	N/A	25.81 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	74.19 %
Unclassified	root	N/A	25.81 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	73.90 %
Unclassified	root	N/A	25.81 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.29 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	58.65 %
Unclassified	root	N/A	25.81 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.05 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.29 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	0.29 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	45.16 %
Unclassified	root	N/A	25.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.47 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.47 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.29 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.29 %
Nitrospinae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae	0.29 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.29 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	24.34 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	2.35 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2.05 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.17 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.88 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.29 %
Thermomicrobia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia	0.29 %
unclassified Nitrospinota	no rank	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota	0.29 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	6.45 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	1.17 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.88 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.88 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.88 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.59 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.29 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	0.29 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.29 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.29 %
Frankiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales	0.29 %
Rhodobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae	0.29 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.29 %
Thermomicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales	0.29 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.29 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4.40 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	0.88 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	0.59 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.59 %
Rhodovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Azorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.29 %
Rhodobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium	0.29 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.29 %
unclassified Rhodobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Frankiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae	0.29 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	0.29 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	0.29 %
Methyloferula	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula	0.29 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	0.88 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.59 %
unclassified Rhodovulum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum	0.59 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	0.29 %
Frankia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
unclassified Afipia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
unclassified Frankia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.35 %
Rhodovulum sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	0.59 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.59 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.59 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.59 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	0.29 %
Frankia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	0.29 %
Nocardioides daphniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	0.29 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	0.29 %
Bradyrhizobium sp. 41S5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	0.29 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.29 %
Afipia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	0.29 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.29 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.29 %
Rhodobium orientis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	0.29 %
Azorhizobium doebereinerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	0.29 %
Methyloferula stellata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	0.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.29 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.29 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.29 %
Bradyrhizobium ivorense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	0.29 %
Candidatus Afipia apatlaquensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	0.29 %
Rhodobacteraceae bacterium R_SAG10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	0.29 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.29 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	0.29 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.29 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.29 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.29 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.29 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.29 %
Nitrospinae bacterium SCGC AAA008-D05	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	0.29 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.29 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.29 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000364|INPhiseqgaiiFebDRAFT_100865158	All Organisms → cellular organisms → Bacteria	1243
3300000364|INPhiseqgaiiFebDRAFT_105864527	All Organisms → cellular organisms → Bacteria → Proteobacteria	2805
3300000955|JGI1027J12803_101400003	Not Available	800
3300000955|JGI1027J12803_102453196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1144
3300002245|JGIcombinedJ26739_100797977	Not Available	824
3300003659|JGI25404J52841_10072729	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	718
3300005167|Ga0066672_10228911	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1192
3300005293|Ga0065715_10755766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	604
3300005332|Ga0066388_100205938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2590
3300005332|Ga0066388_101254794	All Organisms → cellular organisms → Bacteria → Proteobacteria	1273
3300005332|Ga0066388_103300538	All Organisms → cellular organisms → Bacteria → Proteobacteria	824
3300005332|Ga0066388_103863228	Not Available	764
3300005332|Ga0066388_106198882	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	604
3300005347|Ga0070668_100718954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	882
3300005353|Ga0070669_100819342	All Organisms → cellular organisms → Bacteria	792
3300005435|Ga0070714_100066374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata	3109
3300005435|Ga0070714_100696750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	980
3300005436|Ga0070713_101603126	All Organisms → cellular organisms → Bacteria	632
3300005511|Ga0077121_10381434	Not Available	995
3300005529|Ga0070741_10079122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3630
3300005529|Ga0070741_10645183	All Organisms → cellular organisms → Bacteria	940
3300005537|Ga0070730_10046120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3177
3300005537|Ga0070730_10054571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2871
3300005538|Ga0070731_10066573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2391
3300005538|Ga0070731_10744302	Not Available	651
3300005543|Ga0070672_100164498	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1842
3300005543|Ga0070672_100516221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1035
3300005554|Ga0066661_10034990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2799
3300005554|Ga0066661_10193080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae	1259
3300005560|Ga0066670_10338992	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	916
3300005561|Ga0066699_10810666	All Organisms → cellular organisms → Bacteria → Proteobacteria	659
3300005562|Ga0058697_10376254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	698
3300005569|Ga0066705_10072232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1994
3300005569|Ga0066705_10094337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1769
3300005587|Ga0066654_10850866	All Organisms → cellular organisms → Bacteria → Proteobacteria	521
3300005598|Ga0066706_11497324	Not Available	508
3300005614|Ga0068856_101610638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	662
3300005617|Ga0068859_101365765	Not Available	781
3300005617|Ga0068859_101681629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	701
3300005713|Ga0066905_100745110	Not Available	845
3300005713|Ga0066905_101047262	All Organisms → cellular organisms → Bacteria → Proteobacteria	722
3300005713|Ga0066905_101381381	Not Available	637
3300005764|Ga0066903_100141684	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3422
3300005764|Ga0066903_100205826	All Organisms → cellular organisms → Bacteria	2954
3300005764|Ga0066903_100341184	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2412
3300005764|Ga0066903_100410323	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2235
3300005764|Ga0066903_100702193	Not Available	1783
3300005764|Ga0066903_100740488	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.	1743
3300005764|Ga0066903_101066530	All Organisms → cellular organisms → Bacteria	1485
3300005764|Ga0066903_101155265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	1433
3300005764|Ga0066903_101412467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1308
3300005764|Ga0066903_101446814	All Organisms → cellular organisms → Bacteria → Proteobacteria	1294
3300005764|Ga0066903_101891281	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	1143
3300005764|Ga0066903_101963822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1123
3300005764|Ga0066903_102630344	All Organisms → cellular organisms → Bacteria	976
3300005764|Ga0066903_103151355	All Organisms → cellular organisms → Bacteria	892
3300005764|Ga0066903_103922119	All Organisms → cellular organisms → Bacteria	798
3300005764|Ga0066903_104088257	All Organisms → cellular organisms → Bacteria → Proteobacteria	782
3300005764|Ga0066903_104582607	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	737
3300005764|Ga0066903_105079050	Not Available	697
3300005764|Ga0066903_105462464	Not Available	670
3300005764|Ga0066903_105534303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.	666
3300005764|Ga0066903_106509272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis	609
3300005764|Ga0066903_107141979	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	578
3300005764|Ga0066903_108419928	Not Available	526
3300005921|Ga0070766_10489950	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	815
3300005921|Ga0070766_10641246	Not Available	716
3300005921|Ga0070766_10675967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	698
3300005983|Ga0081540_1000183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	65356
3300005983|Ga0081540_1325382	All Organisms → cellular organisms → Bacteria → Proteobacteria	527
3300005985|Ga0081539_10013948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	5997
3300006028|Ga0070717_10038681	All Organisms → cellular organisms → Bacteria → Proteobacteria	3878
3300006028|Ga0070717_10236476	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.	1610
3300006028|Ga0070717_10705525	All Organisms → cellular organisms → Bacteria	917
3300006028|Ga0070717_10867336	Not Available	822
3300006028|Ga0070717_11014378	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	756
3300006028|Ga0070717_11152608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	706
3300006028|Ga0070717_11297931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	662
3300006032|Ga0066696_10894863	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	565
3300006038|Ga0075365_10826087	All Organisms → cellular organisms → Bacteria	654
3300006052|Ga0075029_100184340	Not Available	1297
3300006057|Ga0075026_100081798	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1576
3300006057|Ga0075026_101062144	Not Available	507
3300006059|Ga0075017_101374381	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	555
3300006163|Ga0070715_10004479	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4589
3300006163|Ga0070715_10147655	Not Available	1149
3300006163|Ga0070715_10215783	Not Available	983
3300006172|Ga0075018_10436996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	672
3300006173|Ga0070716_100968836	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05	671
3300006173|Ga0070716_101438367	All Organisms → cellular organisms → Bacteria	562
3300006175|Ga0070712_100522093	All Organisms → cellular organisms → Bacteria	998
3300006175|Ga0070712_101076831	All Organisms → cellular organisms → Bacteria	697
3300006175|Ga0070712_101448801	Not Available	600
3300006175|Ga0070712_101472544	All Organisms → cellular organisms → Bacteria → Proteobacteria	595
3300006176|Ga0070765_100462175	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	1190
3300006176|Ga0070765_100532865	Not Available	1105
3300006176|Ga0070765_101396399	Not Available	660
3300006176|Ga0070765_101963283	All Organisms → cellular organisms → Bacteria → Proteobacteria	548
3300006794|Ga0066658_10572111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	614
3300006796|Ga0066665_11417262	All Organisms → cellular organisms → Bacteria	538
3300006797|Ga0066659_11841132	Not Available	513
3300006806|Ga0079220_11211857	All Organisms → cellular organisms → Bacteria → Proteobacteria	624
3300006854|Ga0075425_100512573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1381
3300006854|Ga0075425_100799615	All Organisms → cellular organisms → Bacteria	1081
3300006854|Ga0075425_100804840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1077
3300006871|Ga0075434_101382823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	714
3300006871|Ga0075434_101474151	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	690
3300006893|Ga0073928_10416084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	980
3300006903|Ga0075426_11515918	All Organisms → cellular organisms → Bacteria	510
3300006904|Ga0075424_102313652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	565
3300006914|Ga0075436_100077857	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2297
3300006914|Ga0075436_100795816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	704
3300006953|Ga0074063_13547546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	764
3300007004|Ga0079218_11506384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	729
3300009143|Ga0099792_11000656	Not Available	558
3300009174|Ga0105241_10979205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	790
3300009235|Ga0103857_10083657	All Organisms → cellular organisms → Bacteria	637
3300009553|Ga0105249_11001568	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	904
3300009799|Ga0105075_1036321	All Organisms → cellular organisms → Bacteria → Proteobacteria	586
3300010040|Ga0126308_10089545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG10	1867
3300010043|Ga0126380_11561351	All Organisms → cellular organisms → Bacteria → Proteobacteria	587
3300010043|Ga0126380_12232898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	507
3300010046|Ga0126384_11299640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	675
3300010046|Ga0126384_11571810	Not Available	618
3300010052|Ga0133944_1001835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	39768
3300010326|Ga0134065_10351894	Not Available	579
3300010358|Ga0126370_12316170	All Organisms → cellular organisms → Bacteria → Proteobacteria	532
3300010360|Ga0126372_11022983	All Organisms → cellular organisms → Bacteria	839
3300010360|Ga0126372_11866735	All Organisms → cellular organisms → Bacteria → Proteobacteria	645
3300010360|Ga0126372_12506594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	567
3300010360|Ga0126372_12626927	All Organisms → cellular organisms → Bacteria → Proteobacteria	555
3300010361|Ga0126378_10561191	All Organisms → cellular organisms → Bacteria	1256
3300010362|Ga0126377_13401120	All Organisms → cellular organisms → Bacteria	514
3300010362|Ga0126377_13496908	Not Available	508
3300010366|Ga0126379_12347238	Not Available	633
3300010366|Ga0126379_12513276	All Organisms → cellular organisms → Bacteria → Proteobacteria	613
3300010376|Ga0126381_100049411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5142
3300010376|Ga0126381_100789221	All Organisms → cellular organisms → Bacteria → Proteobacteria	1363
3300010376|Ga0126381_102185230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	796
3300010376|Ga0126381_102737551	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	704
3300010398|Ga0126383_10279256	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1656
3300010398|Ga0126383_11673502	Not Available	725
3300010398|Ga0126383_13560019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5	509
3300010398|Ga0126383_13597673	Not Available	506
3300010399|Ga0134127_13234872	Not Available	532
3300010400|Ga0134122_10341037	All Organisms → cellular organisms → Bacteria → Proteobacteria	1301
3300010860|Ga0126351_1093772	Not Available	709
3300011271|Ga0137393_10438673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1119
3300011413|Ga0137333_1067446	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	818
3300011445|Ga0137427_10186071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	861
3300012149|Ga0153941_1024039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1187
3300012168|Ga0137357_1031929	All Organisms → cellular organisms → Bacteria	1047
3300012169|Ga0153990_1148844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	522
3300012181|Ga0153922_1038222	All Organisms → cellular organisms → Bacteria → Proteobacteria	1068
3300012199|Ga0137383_10050883	All Organisms → cellular organisms → Bacteria → Proteobacteria	2961
3300012677|Ga0153928_1000131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	39286
3300012685|Ga0137397_11273319	Not Available	525
3300012912|Ga0157306_10071418	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	934
3300012917|Ga0137395_10306278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1126
3300012930|Ga0137407_10877182	All Organisms → cellular organisms → Bacteria	848
3300012971|Ga0126369_10169139	Not Available	2076
3300012971|Ga0126369_10322476	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1555
3300012971|Ga0126369_10597983	Not Available	1173
3300012971|Ga0126369_13580621	Not Available	509
3300013297|Ga0157378_11790161	Not Available	662
3300013306|Ga0163162_13299304	Not Available	517
3300014199|Ga0181535_10118266	Not Available	1689
3300014325|Ga0163163_11216475	Not Available	816
3300014326|Ga0157380_10745776	Not Available	990
3300014326|Ga0157380_12512150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	581
3300014654|Ga0181525_10159444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1236
3300015245|Ga0137409_10037951	All Organisms → cellular organisms → Bacteria → Proteobacteria	4639
3300015264|Ga0137403_10284329	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1554
3300015371|Ga0132258_12704997	Not Available	1238
3300015374|Ga0132255_104288072	Not Available	605
3300016294|Ga0182041_11178990	Not Available	698
3300016319|Ga0182033_10217845	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1530
3300016319|Ga0182033_11377548	All Organisms → cellular organisms → Bacteria	635
3300016404|Ga0182037_10937683	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	752
3300017822|Ga0187802_10000138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	16449
3300017928|Ga0187806_1047310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1304
3300017970|Ga0187783_10010021	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	6965
3300017972|Ga0187781_10131488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1750
3300017972|Ga0187781_10302303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1135
3300017972|Ga0187781_10465735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	906
3300017972|Ga0187781_10656425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	757
3300017975|Ga0187782_10368757	Not Available	1088
3300017975|Ga0187782_10437998	Not Available	996
3300017975|Ga0187782_10537076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	896
3300017975|Ga0187782_10612143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	837
3300017975|Ga0187782_11241375	Not Available	584
3300017994|Ga0187822_10354399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	531
3300018028|Ga0184608_10479795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	533
3300018058|Ga0187766_10341805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	978
3300018062|Ga0187784_10005157	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10576
3300018064|Ga0187773_10771861	Not Available	608
3300018066|Ga0184617_1165587	All Organisms → cellular organisms → Bacteria	654
3300018085|Ga0187772_10508800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	850
3300018422|Ga0190265_10985153	All Organisms → cellular organisms → Bacteria	965
3300018468|Ga0066662_10347898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1273
3300018482|Ga0066669_10842586	All Organisms → cellular organisms → Bacteria → Proteobacteria	815
3300020579|Ga0210407_11317869	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	539
3300020583|Ga0210401_10124452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2418
3300020583|Ga0210401_10458818	Not Available	1137
3300020583|Ga0210401_10947016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	720
3300020583|Ga0210401_11262576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	597
3300021088|Ga0210404_10129854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1303
3300021088|Ga0210404_10470977	All Organisms → cellular organisms → Bacteria	708
3300021088|Ga0210404_10587039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	633
3300021088|Ga0210404_10771314	All Organisms → cellular organisms → Bacteria → Proteobacteria	549
3300021170|Ga0210400_10736492	Not Available	810
3300021170|Ga0210400_10795038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	776
3300021178|Ga0210408_10001493	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	24410
3300021178|Ga0210408_10002061	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	20080
3300021178|Ga0210408_10003067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	15618
3300021362|Ga0213882_10131584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1021
3300021374|Ga0213881_10046827	All Organisms → cellular organisms → Bacteria	1828
3300021374|Ga0213881_10094358	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1291
3300021374|Ga0213881_10105791	Not Available	1219
3300021374|Ga0213881_10124120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1124
3300021384|Ga0213876_10046722	All Organisms → cellular organisms → Bacteria → Proteobacteria	2289
3300021384|Ga0213876_10175794	All Organisms → cellular organisms → Bacteria → Proteobacteria	1139
3300021384|Ga0213876_10187594	All Organisms → cellular organisms → Bacteria	1100
3300021388|Ga0213875_10390313	Not Available	663
3300021388|Ga0213875_10588503	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	537
3300021407|Ga0210383_11390435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	584
3300021432|Ga0210384_10178347	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1909
3300021432|Ga0210384_10202562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1784
3300021439|Ga0213879_10170354	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	639
3300021476|Ga0187846_10048621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1881
3300021476|Ga0187846_10276633	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	696
3300021476|Ga0187846_10381184	All Organisms → cellular organisms → Bacteria	580
3300021478|Ga0210402_11395601	All Organisms → cellular organisms → Bacteria → Proteobacteria	628
3300021559|Ga0210409_10008185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	10676
3300021560|Ga0126371_10025926	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5450
3300025297|Ga0209758_1104827	Not Available	795
3300025474|Ga0208479_1089993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	567
3300025901|Ga0207688_10191783	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1222
3300025904|Ga0207647_10405194	Not Available	768
3300025904|Ga0207647_10803021	Not Available	506
3300025906|Ga0207699_10506859	All Organisms → cellular organisms → Bacteria	872
3300025906|Ga0207699_10863498	All Organisms → cellular organisms → Bacteria	667
3300025908|Ga0207643_10204423	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	1204
3300025914|Ga0207671_10345337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	1180
3300025928|Ga0207700_10459688	Not Available	1123
3300025929|Ga0207664_10406573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1211
3300025929|Ga0207664_10568537	Not Available	1018
3300025933|Ga0207706_11523562	All Organisms → cellular organisms → Bacteria	544
3300025936|Ga0207670_11396950	Not Available	594
3300025938|Ga0207704_11652226	Not Available	550
3300025986|Ga0207658_10956462	Not Available	781
3300026088|Ga0207641_11577505	All Organisms → cellular organisms → Bacteria	658
3300026309|Ga0209055_1111495	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae	1064
3300026530|Ga0209807_1054676	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1828
3300026550|Ga0209474_10461317	All Organisms → cellular organisms → Bacteria → Proteobacteria	645
3300026552|Ga0209577_10035697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4294
3300026552|Ga0209577_10138614	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1927
3300026552|Ga0209577_10176630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1659
3300026552|Ga0209577_10411908	Not Available	967
3300026552|Ga0209577_10431706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	930
3300026863|Ga0209902_103672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3159
3300026988|Ga0207834_1025796	All Organisms → cellular organisms → Bacteria → Proteobacteria	701
3300027857|Ga0209166_10271865	All Organisms → cellular organisms → Bacteria → Proteobacteria	896
3300027869|Ga0209579_10404010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	740
3300027874|Ga0209465_10116047	All Organisms → cellular organisms → Bacteria	1318
3300027874|Ga0209465_10496134	Not Available	610
3300027889|Ga0209380_10123471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1507
3300027898|Ga0209067_10932309	Not Available	511
3300028720|Ga0307317_10157263	Not Available	764
3300028824|Ga0307310_10645670	Not Available	541
3300028906|Ga0308309_10629618	All Organisms → cellular organisms → Bacteria	931
3300028906|Ga0308309_11136370	Not Available	675
3300028906|Ga0308309_11648426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	545
3300029636|Ga0222749_10166291	All Organisms → cellular organisms → Bacteria	1084
3300031057|Ga0170834_104548438	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1237
3300031128|Ga0170823_15951238	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1432
3300031226|Ga0307497_10170933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	919
3300031446|Ga0170820_11242908	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	969
3300031446|Ga0170820_15065383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2361
3300031543|Ga0318516_10780041	All Organisms → cellular organisms → Bacteria	540
3300031544|Ga0318534_10538718	Not Available	665
3300031545|Ga0318541_10039669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2377
3300031547|Ga0310887_10780036	Not Available	599
3300031564|Ga0318573_10734023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	531
3300031682|Ga0318560_10084349	All Organisms → cellular organisms → Bacteria	1625
3300031711|Ga0265314_10005299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	11670
3300031715|Ga0307476_10676740	Not Available	764
3300031715|Ga0307476_10764869	Not Available	715
3300031718|Ga0307474_11078360	Not Available	636
3300031720|Ga0307469_11234681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	708
3300031720|Ga0307469_11919128	Not Available	574
3300031730|Ga0307516_10761931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	628
3300031744|Ga0306918_11338355	All Organisms → cellular organisms → Bacteria	550
3300031753|Ga0307477_10390864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis	953
3300031753|Ga0307477_10799874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	626
3300031765|Ga0318554_10585779	Not Available	629
3300031768|Ga0318509_10452311	Not Available	718
3300031768|Ga0318509_10491478	All Organisms → cellular organisms → Bacteria → Proteobacteria	686
3300031782|Ga0318552_10526354	All Organisms → cellular organisms → Bacteria → Proteobacteria	603
3300031797|Ga0318550_10129320	All Organisms → cellular organisms → Bacteria	1205
3300031820|Ga0307473_11448076	All Organisms → cellular organisms → Bacteria → Proteobacteria	519
3300031823|Ga0307478_10465632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1052
3300031823|Ga0307478_10595769	Not Available	924
3300031823|Ga0307478_11547669	Not Available	548
3300031845|Ga0318511_10439477	All Organisms → cellular organisms → Bacteria → Proteobacteria	600
3300031854|Ga0310904_10634318	Not Available	733
3300031858|Ga0310892_11290434	Not Available	522
3300031879|Ga0306919_11206137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	575
3300031890|Ga0306925_11948966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	556
3300031912|Ga0306921_10831275	All Organisms → cellular organisms → Bacteria → Proteobacteria	1053
3300031912|Ga0306921_11751775	Not Available	670
3300031941|Ga0310912_11203529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	576
3300031954|Ga0306926_11360957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	826
3300031959|Ga0318530_10215219	All Organisms → cellular organisms → Bacteria → Proteobacteria	789
3300032039|Ga0318559_10460897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	593
3300032059|Ga0318533_10790554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	696
3300032059|Ga0318533_10801756	All Organisms → cellular organisms → Bacteria → Proteobacteria	691
3300032068|Ga0318553_10631302	Not Available	561
3300032076|Ga0306924_12239925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	556
3300032174|Ga0307470_10112709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1587
3300032174|Ga0307470_11853545	Not Available	512
3300032205|Ga0307472_100479727	All Organisms → cellular organisms → Bacteria	1066
3300032205|Ga0307472_101246647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	713
3300032205|Ga0307472_102025890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	577
3300032261|Ga0306920_102138839	All Organisms → cellular organisms → Bacteria	780
3300032892|Ga0335081_10000845	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	49278
3300032892|Ga0335081_10701264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1228
3300032954|Ga0335083_11406695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense	533
3300033004|Ga0335084_11434861	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	684
3300033158|Ga0335077_10768210	All Organisms → cellular organisms → Bacteria → Proteobacteria	985
3300033158|Ga0335077_10876279	All Organisms → cellular organisms → Bacteria	907
3300033158|Ga0335077_11152356	Not Available	762
3300033289|Ga0310914_10045808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3584
3300033550|Ga0247829_10508301	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	998
3300034155|Ga0370498_066558	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	813
3300034155|Ga0370498_134200	Not Available	591

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	83.87%
Host-Associated	Host-Associated	16.13%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	77.71%
Plants	Host-Associated → Plants	14.66%
Aquatic	Environmental → Aquatic	6.16%
Fungi	Host-Associated → Fungi	1.17%
Microbial	Host-Associated → Microbial	0.29%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	75.37%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.45%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.57%
Sediment	Environmental → Aquatic → Sediment	3.23%
Freshwater	Environmental → Aquatic → Freshwater	2.35%
Roots	Host-Associated → Plants → Roots	2.35%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	1.47%
Mycelium	Host-Associated → Fungi → Mycelium	1.17%
Cave	Environmental → Terrestrial → Cave	0.88%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.29%
Unclassified	Environmental → Aquatic → Unclassified	0.29%
Bacteria	Host-Associated → Microbial → Bacteria	0.29%
Phylloplane	Host-Associated → Plants → Phylloplane	0.29%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	46.92%
Loam	Environmental → Terrestrial → Soil → Loam	21.11%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	7.04%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.69%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.40%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.23%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.05%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.76%
Unclassified	Host-Associated → Plants → Roots → Unclassified	1.76%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	1.47%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	1.17%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.88%
Lake	Environmental → Aquatic → Freshwater → Lake	0.29%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.29%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.29%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.29%
Sand	Environmental → Terrestrial → Soil → Sand	0.29%
Unclassified	Host-Associated → Microbial → Bacteria → Unclassified	0.29%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.29%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.29%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.29%

Subtype

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	20.82%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	16.13%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	13.78%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.92%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.33%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	7.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.69%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.40%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.23%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.05%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	1.76%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	1.47%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.17%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	1.17%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.88%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.88%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.88%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.59%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.29%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.29%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.29%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.29%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.29%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.29%
Unclassified	Host-Associated → Microbial → Bacteria → Unclassified → Unclassified	0.29%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.29%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.29%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.29%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.44%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	10.26%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	7.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.33%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.87%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	4.69%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.52%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	3.23%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.64%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.35%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.35%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.05%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.47%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	1.47%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	1.47%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.17%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.17%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.17%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	1.17%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.88%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.88%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.88%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.59%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.59%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.59%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.59%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.59%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.59%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.59%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.59%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.59%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.59%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.29%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.29%
River Water	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water	0.29%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.29%
Liquid	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Liquid	0.29%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.29%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.29%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.29%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.29%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.29%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.29%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.29%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.29%
Cyanobacterial	Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial	0.29%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.29%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.29%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.29%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.29%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.29%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	0.29%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.29%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.29%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.29%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.29%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.29%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.29%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental
3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental
3300005511	Combined assembly of arab plate scrape MF_Col (Combined Assembly)	Host-Associated
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009235	Microbial communities of water from Amazon river, Brazil - RCM10	Environmental
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009799	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30	Environmental
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010052	Microbial community associated with the xenic strain of Eucapsis sp. UTEX 1529	Environmental
3300010326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010860	Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental
3300011413	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2	Environmental
3300011445	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2	Environmental
3300012149	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ025 MetaG	Host-Associated
3300012168	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2	Environmental
3300012169	Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG	Host-Associated
3300012181	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG	Host-Associated
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental
3300012677	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaG	Host-Associated
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300014199	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014654	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG	Environmental
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental
3300017822	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2	Environmental
3300017928	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1	Environmental
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental
3300018015	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150	Environmental
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental
3300018085	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG	Environmental
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental
3300021362	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09	Environmental
3300021374	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08	Environmental
3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Host-Associated
3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Host-Associated
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental
3300021439	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03	Environmental
3300021476	Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)	Environmental
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300022553	Powell_combined assembly	Environmental
3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes)	Host-Associated
3300025474	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes)	Environmental
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026309	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)	Environmental
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental
3300026863	Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes)	Host-Associated
3300026988	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 5 (SPAdes)	Environmental
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental
3300027889	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)	Environmental
3300027898	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)	Environmental
3300028720	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357	Environmental
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental
3300029636	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)	Environmental
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental
3300031564	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21	Environmental
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental
3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Host-Associated
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental
3300031768	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22	Environmental
3300031782	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20	Environmental
3300031797	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23	Environmental
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental
3300031959	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24	Environmental
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental
3300033158	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1	Environmental
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental
3300034155	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1008651582	3300000364	Soil	MILSDLPTPPEATFHAMGPWKGFAQAGNRCPLFGIM
INPhiseqgaiiFebDRAFT_1058645271	3300000364	Soil	MILSDLPTPASVHATGSCKGFAQAGNRYALLRIMRQ
JGI1027J12803_1014000031	3300000955	Soil	CLRMILSDLPTPAEASVRAVRPRKGFAQAGTRYTLFGIMR*
JGI1027J12803_1024531961	3300000955	Soil	MILSDLPTPAEASVHAIGSRKGFAQAGNRFTSRIKS
JGIcombinedJ26739_1007979771	3300002245	Forest Soil	IFSDLPSPAEASSQMTNRATGFAQAGNRCPLFGIML*
JGI25404J52841_100727291	3300003659	Tabebuia Heterophylla Rhizosphere	LSDLPLPAEASSQTESPAKGFAQAGNRSPFFGIMLYQRTR*
Ga0066672_102289112	3300005167	Soil	MSMIFSDLPSPAEASSRATNSAKGFAQAGNRYPLFGIML*
Ga0065715_107557662	3300005293	Miscanthus Rhizosphere	LSLCLRMVLSDLPTPAEASGHATGPRKGFAQAGNRFTLFGIMR*
Ga0066388_1002059383	3300005332	Tropical Forest Soil	VHAFSESMIFSDLASPAEASGHATKRTKGFAQAGNRYPLFGIML*
Ga0066388_1012547942	3300005332	Tropical Forest Soil	MILSDLASFAEASNETANGWRGFAQAGNRYPLFGIILQAVRA*
Ga0066388_1033005382	3300005332	Tropical Forest Soil	YLSMIFSDLASPAEALTEGTSRWQGFAQAGNRFPLFRIML*
Ga0066388_1038632282	3300005332	Tropical Forest Soil	WWSMIFSDLPSPAEASVLTAGACKGSAQAGNRFTLFGIML*
Ga0066388_1061988822	3300005332	Tropical Forest Soil	MIFSGLASPAEASNRNNGPIMGFAKAGNRYPLFGIMLWARDKGWR
Ga0070668_1007189541	3300005347	Switchgrass Rhizosphere	WSMIFSDLPSPAEASIHAGGPRHGFAQAGNRYPLFGIMLEGY*
Ga0070669_1008193422	3300005353	Switchgrass Rhizosphere	MRMILSDLPTPAEASVREIRGCPGFAQAGNRYPLFGIMRYRGASAS
Ga0070714_1000663744	3300005435	Agricultural Soil	MIFSDLASPAEASNQVTKRCKGFAQAGNRYPLFGIMRYAANGCLT*
Ga0070714_1006967503	3300005435	Agricultural Soil	MISRVFWSMMFSDLPSPAEALSHTTSNAAGFAQAGNRYPLFGIML*
Ga0070713_1016031262	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLPSPAEASTRTEGLCRGFAQAENRYPVFGIMLKRDCEP*
Ga0077121_103814342	3300005511	Arabidopsis Rhizosphere	MIFSDLPAPAEASVLPTRICRGFAQAGNRDTLFGIMLAGS*
Ga0070741_100791225	3300005529	Surface Soil	VILSDLPSPAEASILHEVRRDGFAQAGNRCERFGITRETTSQAS*
Ga0070741_106451832	3300005529	Surface Soil	MIFSDLPSPAEASIRWEDRCDGFAQAGNRHPLFGIML*
Ga0070730_100461204	3300005537	Surface Soil	MIFSDLPSPAEASSRTNNASQGFAQAENRFPLFRIML*
Ga0070730_100545715	3300005537	Surface Soil	MIFSDLPSPAEASGRMEGLCTGFAQAGNRCTLFRIML*
Ga0070731_100665734	3300005538	Surface Soil	MIFSDLPSPAEASSQIDEQCQGFAQAGNRRPLFGIML*
Ga0070731_107443022	3300005538	Surface Soil	MILSDLPWPAEASSQTDAPCQGFAQAGNRRPLFGIMLYGFK
Ga0070672_1001644982	3300005543	Miscanthus Rhizosphere	MRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLFGIMR*
Ga0070672_1005162211	3300005543	Miscanthus Rhizosphere	MIFSDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR*
Ga0066661_100349902	3300005554	Soil	MIFSDLPSPAEASSQTTDRGRGFAQAGNRYPLFGIML*
Ga0066661_101930802	3300005554	Soil	MIFSDLPSPAEASSQVTSLATGFAQAGNRYPLFGIML*
Ga0066670_103389922	3300005560	Soil	MIFSDLPSPAEALSESATRCHGFAQAGNRFPLFGIML*
Ga0066699_108106662	3300005561	Soil	CLSMIFPDLPSPAEATNERTGVSQGFAQAGNRHPLFGIMR*
Ga0058697_103762542	3300005562	Agave	MIFSDLPTPAEASVDSQTVQGFAQAGNRYPLFGIML*
Ga0066705_100722322	3300005569	Soil	MIFSDLASPAEARVATRDRYEGFAQAGNRYSLFGIML*
Ga0066705_100943372	3300005569	Soil	MIFSDLASPAEAANESRGGWPGFAQAGNRYPLFGIML*
Ga0066654_108508662	3300005587	Soil	YCLSMIFSDLPSPAEASNETANRCLGFAQAGNRFPLFGIML*
Ga0066706_114973241	3300005598	Soil	MILSDLPSPAEASNETTNRCLGFAQAGNRFPLFGIM
Ga0068856_1016106383	3300005614	Corn Rhizosphere	MIFPDLPSPAEAAIHEFGRCRGFAQAGNRFPLFGIML*
Ga0068859_1013657652	3300005617	Switchgrass Rhizosphere	MIFSDQPSPAEASIHNRRRCQGFAQAGNCFTLFGIMRPSPERA*
Ga0068859_1016816292	3300005617	Switchgrass Rhizosphere	MIFSDLPTPAEASVLSTRMCRGFAQAGNRDTLFGIMLAGS*
Ga0066905_1007451101	3300005713	Tropical Forest Soil	MIFSDLPSPAEALSHTTGLCKGFAQAGNRYPLLARA
Ga0066905_1010472622	3300005713	Tropical Forest Soil	MIFSDLASPAEALTESTGRRQGFAQAGNRYPLFRTML*
Ga0066905_1013813812	3300005713	Tropical Forest Soil	MIFSDLPSPAEASSHRAGCANGFAQAGNRYPLFGIMLYARSACRTERKN*
Ga0066903_1001416842	3300005764	Tropical Forest Soil	MIFSDLPSPAEASSHTTNSAKGFAQAGNRYPLFGIVL*
Ga0066903_1002058262	3300005764	Tropical Forest Soil	MMFSDLPSPAEASSQTTTGATGFAQAGNRYPLFGIML*
Ga0066903_1003411844	3300005764	Tropical Forest Soil	MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIML*
Ga0066903_1004103232	3300005764	Tropical Forest Soil	MDSSFIVWSMIFSDLPSPAEASSKTTNRARGFAQAGNRYPLFGIML*
Ga0066903_1007021932	3300005764	Tropical Forest Soil	MMFSDLPSPAEASSQTTDGAKGFAQAGNRYPLFGIML*
Ga0066903_1007404882	3300005764	Tropical Forest Soil	MIFSDLPSPAEALSQSMTDATGFAQAGNRFPLFGIMR*
Ga0066903_1010665303	3300005764	Tropical Forest Soil	MIFSDLPSLAEASSQTTKRATGFAQAGNRYPLFGIML*
Ga0066903_1011552652	3300005764	Tropical Forest Soil	MIFSDLPSPAEAPSRTMNLATGFAQAGNRYPLFGIML*
Ga0066903_1014124672	3300005764	Tropical Forest Soil	MIFTDLPSPAEASSRTTDGAKGFAQAGNRYPLFGIM
Ga0066903_1014468143	3300005764	Tropical Forest Soil	MIFSDLPSPAEASCEQISGWQSFAQAENPSPLFRIML*
Ga0066903_1018912812	3300005764	Tropical Forest Soil	MIFSDLPSPAEASFYALEACQGFAQAGNRFPLFGIMHR*
Ga0066903_1019638222	3300005764	Tropical Forest Soil	MSFSDLPSPAEAFFDAAGVCQGFAQAGNRCTLFGIML*
Ga0066903_1023735623	3300005764	Tropical Forest Soil	MIFSDLASPAEASCKTMNRTKGYAQAGNRYPLFGIMLQGHFAAFASL*
Ga0066903_1026303442	3300005764	Tropical Forest Soil	MIFSDLPSPAEASSQTTIGATGFAQAGNRYPLFGIML*
Ga0066903_1031513554	3300005764	Tropical Forest Soil	MIYSDLPSPAEASSHTTDCAKGFAQVGNRHPLFGIML*
Ga0066903_1039221192	3300005764	Tropical Forest Soil	MIFSDLASPAEATSHMKFGGQGFAQAGNRYPLFGIMR*
Ga0066903_1040882572	3300005764	Tropical Forest Soil	MIFSDLASPAEALTESTGRRQGFAQAGNRYPLFRTMR*
Ga0066903_1045826072	3300005764	Tropical Forest Soil	MIFSDLPSPAEASSQTTNGAKGFAQAGNRYPLFGIML*
Ga0066903_1050790502	3300005764	Tropical Forest Soil	MILSDLASPAEASSRTTDSAKGFAQAGNRYPLFAIML*
Ga0066903_1054624641	3300005764	Tropical Forest Soil	MIFSDLPSPAEASAHTPRACKGFAQAGNRYPLFGIVL
Ga0066903_1055343032	3300005764	Tropical Forest Soil	MIFSDLPSPAEASSQTTTGATGFAQAGNRYPLFGIML*
Ga0066903_1065092722	3300005764	Tropical Forest Soil	SDLPSPAEASFHTAGVCGGFAQAGNRFTLFGIMLEERMR*
Ga0066903_1071419792	3300005764	Tropical Forest Soil	MIFSDLPSPAEASSHATDRAKGFAQAGNRYPLFGIML*
Ga0066903_1084199282	3300005764	Tropical Forest Soil	MIFSDLPSPAEASNQAMDCAKGFAQAGNRYPLFGIMR
Ga0070766_104899502	3300005921	Soil	SMILSDLPSPAEAGFAQAGNRYPLFGTMRCCPYPLTAPVSPAT*
Ga0070766_106412462	3300005921	Soil	MIFSDLPSPAEAPGQMTSPYQGFAQAGNRYPLFGIM
Ga0070766_106759672	3300005921	Soil	SFPDLPSPAEASSQTDQRRQGFAQAGNRYPLFGIML*
Ga0081540_100018358	3300005983	Tabebuia Heterophylla Rhizosphere	MIFSDLPSPAEATSRTAEAHQGFAQAGNRHPLFGIVL*
Ga0081540_13253822	3300005983	Tabebuia Heterophylla Rhizosphere	MIFSDLPWPAEACFDAAGARQGFAQAGDRVSLFGIMR*
Ga0081539_100139486	3300005985	Tabebuia Heterophylla Rhizosphere	MIFSDLPAPAEALVDRVRPCQGFAQAGNRFPLFEIML*
Ga0070717_100386813	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLPSPAEASSQTANCAKGFAQAGNRYPLFGIML*
Ga0070717_102364761	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLASPAEARRHTMNRAKGFAQAGNRFPLFGIML*
Ga0070717_107055252	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLPSPAEASSRMDGSLEGFAQAGNRYPLFGIMLA*
Ga0070717_108673361	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	TSSWSMIFSDLPSPAEASSETAKRATGFAQAGNRFPLFGVMLE*
Ga0070717_110143782	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLPSPAEASNNTKNRCQGFAQAGNRFPLFGIVL*
Ga0070717_111526082	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLASPAEASSQTNFGGQGFAQAGNRFPLFGIML*
Ga0070717_112979313	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLASPAEASSHTKLGGQGFAQAGNRFPLFGIML*
Ga0066696_108948632	3300006032	Soil	MIFSDQPSPAEASNETTNRWLGFAQAGNRFPLFGIML*
Ga0075365_108260872	3300006038	Populus Endosphere	LSVIFSDLPSPAEALIHTRGLSKGFAQAGNRFPLFGIML
Ga0075029_1001843401	3300006052	Watersheds	MIFSDLPSPAEAPLETTDQHAGFAQAGNRYALFWIML*
Ga0075026_1000817982	3300006057	Watersheds	MILSDLPSPAEAVSEIAMFAKGFAQAGNRFPLFGIMR*
Ga0075026_1010621442	3300006057	Watersheds	MIFSDPASPAEAGHESNSGQSFAQAGNRHPLFGIML
Ga0075017_1013743812	3300006059	Watersheds	MIFSDLASPAEALYETISRLHGFAQAGNRRPLFGIML*
Ga0070715_100044793	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MFSDLASPAEAPSHTMKRSKGFAQAGNRYPLFGIMLYCSGP*
Ga0070715_101476552	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MMFSDLPSPAEASTQTTSRATGFAQAGKPYPLFGIMR*
Ga0070715_102157832	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	VAAVYFWSMIFSDLPSPAEASSHTTSRATGFAQAGNRYPLFGIMR*
Ga0075018_104369962	3300006172	Watersheds	MIFSDLPSPAEASNGKTKVWQGFAQAGNRFPLFRILL*
Ga0070716_1009688362	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLPSPAEASSQMTEQLQGFAQAGNRSPLFGIMLR*
Ga0070716_1014383672	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLPSPAEAPSQTTNRAKGFAQAGNRYPLFGIML*
Ga0070712_1005220932	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLASPAEASSPNDGPIMGFAKAGNRYPLFGIML*
Ga0070712_1010768311	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	IFSDLASPAEASSPTTFDGQGFAQAGNRLLLFGIML*
Ga0070712_1014488011	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	SMMFSDLPSPAEASTQTTSRATGFAQAGKPYPLFGIML*
Ga0070712_1014725442	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLASPAEAWNGDTSSWHGFAQAGNRYPLFGIML*
Ga0070765_1004621752	3300006176	Soil	MMFPDLPSPAEALCQTTNGTMGFAQAGNRYPLFGIML*
Ga0070765_1005328651	3300006176	Soil	MIFSDLPSPAEAPSQMTSRNQGFAQAGNRYPLFGIML
Ga0070765_1013963992	3300006176	Soil	MIFSDLPSPAEASNNTTNRCHGFAQAGNRFPLFGIMP*
Ga0070765_1019632831	3300006176	Soil	MILPDLPSPAEASGQSHRLRQGFAQAGTRHPLFGIML*
Ga0066658_105721112	3300006794	Soil	MILSDLPTPAEVFVHEKRLRQGFAQAGNRCPLFGIMR*
Ga0066665_114172622	3300006796	Soil	FSDLPSPAEASNETTNRCLGFAQAENRFPLFGIMP*
Ga0066659_118411321	3300006797	Soil	MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIMR*
Ga0079220_112118572	3300006806	Agricultural Soil	MIFPDLPSPAEASKKDKQLLGFAQAGNRYPLSGIML*
Ga0075425_1005125732	3300006854	Populus Rhizosphere	MIFSDLPSPAEASSQTMIGATGFAQAGNRFPLFGIML*
Ga0075425_1007996152	3300006854	Populus Rhizosphere	MIFSDLPSPAEAASKTTTGATGFAQAGNRFPLFGIML*
Ga0075425_1008048403	3300006854	Populus Rhizosphere	MIFSDLPSPAEASSQTTTGTTGFAQAGNRYPLFGIML*
Ga0075434_1013828231	3300006871	Populus Rhizosphere	PFCWSMIFSDLPSPAEASSQTTNRNKGFAQAGNRSPLFGIML*
Ga0075434_1014741512	3300006871	Populus Rhizosphere	MIFSDLASPPEASSQTNFGGQGFAQAGNRFSLFGIML*
Ga0073928_104160842	3300006893	Iron-Sulfur Acid Spring	MIFSDLPSPAEASNEPTRSWLSFAQAGNRYPLFGIML*
Ga0075426_115159182	3300006903	Populus Rhizosphere	CLSMIFSDLPSPAEASTRTEGLCRGFAQAENRYPVFGIMLKRDCEP*
Ga0075424_1023136521	3300006904	Populus Rhizosphere	MIFSDLPSPAEAPSPSSRYRLGFAQAGNRYPLFGIML
Ga0075436_1000778572	3300006914	Populus Rhizosphere	MICSDLPSPAEASSQMTEPSQGFAQAGNRYPLFGIML*
Ga0075436_1007958162	3300006914	Populus Rhizosphere	MIFSDLASPAEASSHTTFSGQGFAQAGNRYPLFGIML*
Ga0074063_135475463	3300006953	Soil	SMILSDLPTPAEASVHKSGPYLGFAQAGNRFPLFGIMR*
Ga0079218_115063842	3300007004	Agricultural Soil	MILSDLPSPAEASSKKGEPCQGFAQAGNRFPLFGIML
Ga0099792_110006562	3300009143	Vadose Zone Soil	MIFSDLPSPAEAPSHSSRYRLGFAQAGNRYPLFGIML*
Ga0105241_109792052	3300009174	Corn Rhizosphere	AAHDFSFWSMIFSDLPSPAEAGFAKAGNRFPLFGIMLTPPR*
Ga0103857_100836572	3300009235	River Water	MIFSDLPSPAEASGNTTRTYQGFAQAGNRFPLFGIML*
Ga0105249_110015682	3300009553	Switchgrass Rhizosphere	CLRMVLSDLPTPAEASGHATGPRKGFAQAGNRFTLFGIMR*
Ga0105075_10363212	3300009799	Groundwater Sand	SDLPSPAEASSQNDEPCQGFAQAGNRFPLFGIML*
Ga0126308_100895454	3300010040	Serpentine Soil	AKSLCMIFSDPPSPAEAFVHKNGPCQGFAQAGNRCPLFGIML*
Ga0126380_115613511	3300010043	Tropical Forest Soil	MISSDLPSPAEAPNHPTGFAKDFAQAGNRRPLFGIMLYCSSGLP
Ga0126380_122328981	3300010043	Tropical Forest Soil	MISSDLPSPAEASSRKDDLNEGFAQAENRRTLFRIAR*
Ga0126384_112996402	3300010046	Tropical Forest Soil	MILSDLPSPAEAAKRMPNQATGFVQAGNRYPLFGIML*
Ga0126384_115718101	3300010046	Tropical Forest Soil	ISFSDLPSPAKASSHAKNLAKGFAQAGNRRPLFRDMR*
Ga0133944_100183537	3300010052	Liquid	MIFSDLPSPAEALPTQKRLSKGSAQAGNRLPLLGIML*
Ga0134065_103518942	3300010326	Grasslands Soil	LDSDWSMILSDLPSPAEASSLTAKNCKGFAQAGNRFPLFGNML*
Ga0126370_123161701	3300010358	Tropical Forest Soil	LGYCWSMMSSDLPSPAEASSQTIDGTKGFAQAGNRFPLFGIML*
Ga0126372_110229832	3300010360	Tropical Forest Soil	MILYDLPSPAEASFQMEGACQGFAQAANRFPLFGIML*
Ga0126372_118667352	3300010360	Tropical Forest Soil	MIFSDLASPAEASSQTTNRAKGFAQAGNRYPLFGIML*
Ga0126372_125065942	3300010360	Tropical Forest Soil	MILSDLPSPAEASSKTSNRARGFAQAGNRFPLFGIMRW*
Ga0126372_126269272	3300010360	Tropical Forest Soil	SSDLPSPAEASSQTIDGTKGFAQAGNRFPLFGIML*
Ga0126378_105611911	3300010361	Tropical Forest Soil	MIFSDLPSPAEAPSKNERHCHGFAQAGNRHPLFGIML*
Ga0126377_134011202	3300010362	Tropical Forest Soil	MIFSDLPSPAEALFDTAGPCRGFAQAGNRVTLFGIML*
Ga0126377_134969082	3300010362	Tropical Forest Soil	LCLIFSNLPSRAEASIHVHERCEGFAQGGNRFPLFGIMH*
Ga0126379_123472382	3300010366	Tropical Forest Soil	CWSMMFSDLPSPAEASSQTTTRATGFAQAGNRYPLFGLML*
Ga0126379_125132762	3300010366	Tropical Forest Soil	MILSDLPSPAEASSHEMNYAKGFAQAGNRYPLFGIMH
Ga0126381_1000494118	3300010376	Tropical Forest Soil	MIFSDLPSPAEASSRMKRWFEGFAQAGNRYPLFGIML*
Ga0126381_1007892212	3300010376	Tropical Forest Soil	MIFPDLPSPAEASSGMPNQATGFAQAGNHYTLFGIML*
Ga0126381_1021852302	3300010376	Tropical Forest Soil	MILFDLPSPAEAPTETANHSDGFAQAGNRFPLVGIMR*
Ga0126381_1027375512	3300010376	Tropical Forest Soil	MIFSDLPSPAEALSENSTGLLGFAQVGNRFPLFRIML*
Ga0126383_102792562	3300010398	Tropical Forest Soil	MIFSDLPSPAEASSNAHGFRQGFAQAGNRCTLSWIVR*
Ga0126383_116735021	3300010398	Tropical Forest Soil	MIFSDLPSPAEASSHATDRAKGFAQAGNRYPLFGIMLLLRT
Ga0126383_135600192	3300010398	Tropical Forest Soil	MIFSDLASPAEALTEKRGRWQGFALAENRYPLFRIML*
Ga0126383_135976732	3300010398	Tropical Forest Soil	MIFSDLSSPAEASSRVKRWLKGFAQAGNRYPLFGIML*
Ga0134127_132348722	3300010399	Terrestrial Soil	MIFSDLPSPAEEGFAKAGNRYPLFGIMRLRRARERLL
Ga0134122_103410372	3300010400	Terrestrial Soil	MIFSDLPTPAEASVNATGPRQGFAQAGNRFTLFGIMLYAPASQ*
Ga0126351_10937722	3300010860	Boreal Forest Soil	SMIFSDLPSPAEAPSQTTNRAKGFAQAGNRYPLFGIML*
Ga0137393_104386732	3300011271	Vadose Zone Soil	MIFSDLASPAEASDEVQMVAKSFAQAGNRFPLFRIML*
Ga0137333_10674461	3300011413	Soil	MILCFAFYWGMTFSDLPSPAKASSQNGEPYQGFAQAGNRFPLFGV
Ga0137427_101860712	3300011445	Soil	LSDLPSPAEAGFAKAGNRYPLFGIMRSNPFDDALAE
Ga0153941_10240392	3300012149	Attine Ant Fungus Gardens	MFFSNPPSPAEAPSQTTIRAKGFAQAGNRYPLFGIML*
Ga0137357_10319292	3300012168	Soil	MILSGLPSPAEAGFAKAGNRFPLFGIMLYDSGTTAICSLNAGRDE
Ga0153990_11488442	3300012169	Attine Ant Fungus Gardens	MIFSDLPSPAEAPSHMMNRTKGFAQAGNRFPLFGIMR*
Ga0153922_10382221	3300012181	Attine Ant Fungus Gardens	IFSDLASPAEAAAGTTNGSQGFAQAGNRCPFLGIML*
Ga0137383_100508837	3300012199	Vadose Zone Soil	MMFPDLPSPAEASSQMTNSAKGFAQAGNRYPLFGIML
Ga0153928_10001318	3300012677	Attine Ant Fungus Gardens	MIFSDLPSPAEASSQTTIGDTGFAQAGNRYPLFGIML*
Ga0137397_112733192	3300012685	Vadose Zone Soil	MIFFDLPTPAEASAHTIALRQGFAQAGNRHPLFGIMP*
Ga0157306_100714182	3300012912	Soil	MILSDLPTPAEASFYTTGRRKGFAQAGNRCTLFGIMR*
Ga0137395_103062782	3300012917	Vadose Zone Soil	MIFFDLPSPAEASAHTIALREGFAQAGNRHPLFGIMP*
Ga0137407_108771821	3300012930	Vadose Zone Soil	MIFSDLPTPAEASVHTIELRQGFAQAGNRYPLFGIM
Ga0126369_101691393	3300012971	Tropical Forest Soil	MIFSDLPSPAEAASHTTDRAKGFAQAGNRYPLFGIMLCALVA
Ga0126369_103224761	3300012971	Tropical Forest Soil	LAYCWSMMFSDLPSPAEAPSQMTTGATGFAQAGNRCPLFGIML*
Ga0126369_105979832	3300012971	Tropical Forest Soil	SMIFSDLPSPAEASSHTTNSAKGFAQAGNRYPLFGIVL*
Ga0126369_135806211	3300012971	Tropical Forest Soil	MIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGIMLW
Ga0157378_117901612	3300013297	Miscanthus Rhizosphere	SDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR*
Ga0163162_132993041	3300013306	Switchgrass Rhizosphere	DLPTPAEASILSTRMCRGFAQAGNRDTLFGIMLAGS*
Ga0181535_101182662	3300014199	Bog	FSDLPSPAEADEFREGRKEGGFAKAGNRYPLFGIML*
Ga0163163_112164751	3300014325	Switchgrass Rhizosphere	IFSDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR*
Ga0157380_107457762	3300014326	Switchgrass Rhizosphere	MILSDLPTPAEAFVHQSGGRQGFAQAGNRVQLFGIMRYGLNP
Ga0157380_125121501	3300014326	Switchgrass Rhizosphere	MRMILSDLPTPAEASVREIRGCPGFAQAGNRYPLFGIM
Ga0181525_101594442	3300014654	Bog	MIFSDLPSPAEADEFREGRKEGGFAKAGNRYPLFGIML*
Ga0137409_100379512	3300015245	Vadose Zone Soil	MIFSDLPSPAEASGRMNGWLEGFAQAGNRYPLFGIML*
Ga0137403_102843292	3300015264	Vadose Zone Soil	MFAYSWSMIFSDLPSPAEAPSHSSRHRLGFAQAGNRYPLFGIML*
Ga0132258_127049972	3300015371	Arabidopsis Rhizosphere	WSMIFSDLASPAEASSHTKFGGQAFAQAGNRYPLFGIML*
Ga0132255_1042880721	3300015374	Arabidopsis Rhizosphere	MIFSDLPTPAEASIHMTRPCQGFAQAGNRYPLFGIMLYF
Ga0182041_111789903	3300016294	Soil	MIFFRLPSPAEASSHTTDRAKGFAQAGNRYPLFGIML
Ga0182033_102178452	3300016319	Soil	MIFSDLASPAEASSETTKPDKGFAQAENRFPLFGIML
Ga0182033_113775481	3300016319	Soil	YWWSMIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGIMLEHDR
Ga0182037_109376832	3300016404	Soil	MIFSDLPSPAEASSHTTDRAKGFAQAGNRHPLFGIMR
Ga0187802_100001388	3300017822	Freshwater Sediment	MIFSDLPSPAEAPLETTDQHAGFAQAGNRYALFWIML
Ga0187806_10473102	3300017928	Freshwater Sediment	MIFSDLPSPAEASNEDTSGWRGFAQAGNRFPLFWIML
Ga0187783_100100215	3300017970	Tropical Peatland	MIFSDLASPAEANPPKPSARAGFAKAENRFPLFGIML
Ga0187781_101314881	3300017972	Tropical Peatland	MISSDLPSPAEALIYRENRCAGFAQAGNRFPLFGIMR
Ga0187781_103023032	3300017972	Tropical Peatland	MIFSDLPSPAEASSQTASRAKGFAQAGNRFPLFGIML
Ga0187781_104657352	3300017972	Tropical Peatland	MIFSDLPSPAEASSQTMNRAKGFAQAGNRYPLFGIML
Ga0187781_106564252	3300017972	Tropical Peatland	WRMMFSDLLSPAETLRETTNRATGFAQAGNRYPLFGIMR
Ga0187782_103687572	3300017975	Tropical Peatland	MIFSDLPSPAEASLQSKGWGEGFAQAGNRYTLFGIMF
Ga0187782_104379982	3300017975	Tropical Peatland	MIFSDLPSPAEASNQTMNRPKGFAQAGNRYPLFGIML
Ga0187782_105370762	3300017975	Tropical Peatland	MIFSDLPSPAEASTQHEGWCASFAQAGNRYTLFGIML
Ga0187782_106121432	3300017975	Tropical Peatland	MIFSDLPSPAEALIRREGGREGYAQAGNRCTLFGIML
Ga0187782_112413751	3300017975	Tropical Peatland	MIFSDLPSPAEASIQCERWREGFAQAGNRCTLFGIM
Ga0187822_103543992	3300017994	Freshwater Sediment	FSMSMILSDLASPAEASNETAISCGSFAQAGNRHPLFGIMLY
Ga0187866_10478581	3300018015	Peatland	MIFSHLPAPADAGFAEAENWNPLFGIMLALARDGAA
Ga0184608_104797952	3300018028	Groundwater Sediment	LSDLPSPAEASSQNGEPCQGFAQAGNRFPLFGIMRYLRI
Ga0187766_103418052	3300018058	Tropical Peatland	MIFSDLASPAEASSQTMIGATGFAQAGNLYPLFGIML
Ga0187784_100051576	3300018062	Tropical Peatland	MIFSDLPSPAEASTQTMNRAKGFAQAGNRHPFFGIML
Ga0187784_101406383	3300018062	Tropical Peatland	MIFSDLASLAEAACRHGSDCELTGHAKAGNRYPLFGIML
Ga0187773_107718612	3300018064	Tropical Peatland	LFEHDLSDLASPAEAENEDASGLHGFAQAANRRPLFGIML
Ga0184617_11655872	3300018066	Groundwater Sediment	SSRSFRLSMIFSDLPTPAEASIHEIGRRQGFAQAGNRYPLFGIML
Ga0187772_105088001	3300018085	Tropical Peatland	MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGITL
Ga0190265_109851532	3300018422	Soil	IFSDLPSPAEAFVHAMGPCQGFAQAGNRCTLFGIML
Ga0066662_103478983	3300018468	Grasslands Soil	MIFSDLPSPAEASSQTTNGAKGFAQAGNRFPLFGIML
Ga0066669_108425863	3300018482	Grasslands Soil	MIFSDLPSPAEASSETTNRCQGFAQAGNRYPLFGI
Ga0210407_113178692	3300020579	Soil	MMFSDLPSPAEASNGTTKVRRGFAQAGNRYSLFGIVL
Ga0210401_101244522	3300020583	Soil	MLSWSMIFSDLPSPAEASSQTMKRAMGFAQAGNRVPLFGIML
Ga0210401_104588182	3300020583	Soil	MMFSDLASPAEASSQTMDCTKGFAQAGNRYPLFGIML
Ga0210401_109470162	3300020583	Soil	MIFSDLPSPAEASSQTTERAKGYAQAGNRFPLFGIMR
Ga0210401_112625761	3300020583	Soil	MIFSDLPSPAEAPSHMMNRTKGFAQAGNRFPLFGIML
Ga0210401_116105322	3300020583	Soil	DGNDYRSGFWWSMIFSDLPSPGEASNETTNRCLGFAQAGNRYLLFGIML
Ga0210404_101298543	3300021088	Soil	MIFSDLASPAEAPSHTMKRTKGFAQAGNRFPLFGIML
Ga0210404_104709772	3300021088	Soil	MIFSDLPSPAEASNHTISSAMGFAQAGNRYPLFGIML
Ga0210404_105870391	3300021088	Soil	SMIFSDLPSPAEASSQTTDSARGFAQAGNRYPLFGIML
Ga0210404_107713142	3300021088	Soil	HPTLAYSWSMIFSDLPSPAEASSETTKHATGLAQAGNRFPLFGTML
Ga0210400_107364921	3300021170	Soil	FSDLASPAEAPSHTMNRRKGFAQAGNRYPLFGIMLYL
Ga0210400_107950382	3300021170	Soil	MLSWSMIFSDLPSPAEASSQMMKRAMGFAQAGNRVPLFGIML
Ga0210408_100014936	3300021178	Soil	MISCDLPSPAEASTHMMNPTKGFAQAGNRYPFFAIML
Ga0210408_1000206116	3300021178	Soil	MMFSDLPSPAEASNHTTSSAAGFAQAGNRYPLFGIML
Ga0210408_100030676	3300021178	Soil	MFSDLASPAEAPSHTMNRRKGFAQAGNRYPLFGIMLYL
Ga0213882_101315842	3300021362	Exposed Rock	MIFSDLPSPAEASFRYEKRRDGFAQAGNRYPLFGIMR
Ga0213881_100468273	3300021374	Exposed Rock	MIFSDLFSPAEAPSQTTKRANGFAQAGNRFLVFGIML
Ga0213881_100943582	3300021374	Exposed Rock	MIFSDLPSPAEASSQTTDRAKGFAQAGNRYPLFGIMR
Ga0213881_101057911	3300021374	Exposed Rock	MIFSDLPSPAEASSQTTNSTTGFAQAGNRYPNFGIMRY
Ga0213881_101241202	3300021374	Exposed Rock	MIFSDLPSSAEASSQPTKRAKGFAQAGNRCPLFGIMR
Ga0213876_100467222	3300021384	Plant Roots	MIFSDLSSPAEASSRHDEMRQGFARAGNRFTLFGIMR
Ga0213876_101757941	3300021384	Plant Roots	VFFKAYWSMIFSDLPSPAEASNPTTNSTKGFAQAGNRYPLFGI
Ga0213876_101875941	3300021384	Plant Roots	MIFSDLPSPAEASADCEERSNGFAQAGNRHPLFGIML
Ga0213875_103903131	3300021388	Plant Roots	MMFSDLPSPAEASSQTTNRATGYAQAGNRYPLFGIML
Ga0213875_105885031	3300021388	Plant Roots	ALGYCWSMMFSDLPSPAEASSDTTNSALGFAQAGSR
Ga0210383_113904352	3300021407	Soil	MIFSDLSSPAEAASQTTIDSAGFAQAGNRCPLFGIML
Ga0210384_101783473	3300021432	Soil	MIFSDLPSPAEASTQNDEPCKGFAQAGNRFPLFGIML
Ga0210384_102025623	3300021432	Soil	MIFSDLPSPAEASSQMTEQLQGFAQAGTRSPLFGIML
Ga0213879_101703541	3300021439	Bulk Soil	FWSMTFSDLASPAEAPSHMMKATKGFAQAGNRFPLFGIMLYLL
Ga0187846_100486212	3300021476	Biofilm	MMFSDLPSPAEASSQLLSRATGFAQAGNRYPLFGIML
Ga0187846_102766331	3300021476	Biofilm	YWSMIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFRIML
Ga0187846_103811842	3300021476	Biofilm	MMFSDLPSPAEASSQLLSRASGFAQAGNRYPLFGIMF
Ga0210402_113956012	3300021478	Soil	MIFSDLSSPAEASSRMNGWLEGFAQAGNRYPLFGIML
Ga0210409_100081855	3300021559	Soil	MFSDLASPAEASSQTMDCTKGFAQAGNRYPLFGIML
Ga0126371_100259265	3300021560	Tropical Forest Soil	MIFSDLPSPAEAPSKNERHCHGFAQAGNRHPLFGIML
Ga0212124_106401102	3300022553	Freshwater	MIFSDLPSPAEAGFAKAGNRVPLFGIMLAHAPFQQC
Ga0209758_11048271	3300025297	Arabidopsis Rhizosphere	GAALLRWSMIFSDLPAPAEASVLPTRICRGFAQAGNRDTLFGIMLAGS
Ga0208479_10899931	3300025474	Arctic Peat Soil	MILSDLPSPAEAGFAKAGNRFPLFGIMRLLPIPQHRLNQRQRRHR
Ga0207688_101917833	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR
Ga0207647_104051942	3300025904	Corn Rhizosphere	MILSDLPAPAEALARVTGSCEGFAQAGNRFTLFGIMRLVTCAAKP
Ga0207647_108030211	3300025904	Corn Rhizosphere	VVLRMIFSDLPSPSEAPARTGGLCWGFAQAGNRFPLFGIMRA
Ga0207699_105068592	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLPSPAEASSRAEGLPKGFAQAGNRCTLFRIMRSERAADRQ
Ga0207699_108634982	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLPSPAEASSKNEQPCEGFAQAGNRRPLFGIML
Ga0207643_102044231	3300025908	Miscanthus Rhizosphere	MIFSDLPSPAEALVYATGPCQGFAQAGNRRPLFGI
Ga0207671_103453371	3300025914	Corn Rhizosphere	YCVRMILSDLPTPAEASGHATGPRKGFAQAGNRFTLFESRR
Ga0207700_104596881	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MIFSDLPSPAEASNETTNRCLGFAQAGNRYPLFGIMLRIS
Ga0207664_104065731	3300025929	Agricultural Soil	MIFSDLPSPAEAGFAKAGNRYPLFGIMRLRRARERLLSGRR
Ga0207664_105685371	3300025929	Agricultural Soil	GHALACCLSMIFSDLPSPAEASSQPTIGATGFAQAGNRYTLFGIML
Ga0207706_115235622	3300025933	Corn Rhizosphere	MRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLF
Ga0207670_113969502	3300025936	Switchgrass Rhizosphere	SMIWSDLPSPAEASVRSVASCQGFAQAGNRFPLFGIMLL
Ga0207704_116522262	3300025938	Miscanthus Rhizosphere	YWWSMIISDLPSPAEAFVHTAGLCQGFAQAGNRSTLFGIKH
Ga0207658_109564622	3300025986	Switchgrass Rhizosphere	EPGQRSVIRLLIFLSTIFSDLPSPAEAGFAKAGNRFTLFGIMP
Ga0207641_115775052	3300026088	Switchgrass Rhizosphere	MRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLFGISG
Ga0209055_11114953	3300026309	Soil	MIFSDLPSPAEASSQVTSLATGFAQAGNRYPLFGIML
Ga0209807_10546762	3300026530	Soil	MIFSDLASPAEAANESRGGWPGFAQAGNRYPLFGIML
Ga0209474_104613171	3300026550	Soil	LNMIFSNLPSPAEASNETTSRCLGFAQAGNQFPLFGIML
Ga0209577_100356972	3300026552	Soil	MSMIFSDLPSPAEASSRATNSAKGFAQAGNRYPLFGIML
Ga0209577_101386142	3300026552	Soil	MMFSDLPSPAEASNGTTKVRRGFAQAGNRYPLFGIVL
Ga0209577_101766301	3300026552	Soil	HLYLLIRRAFCLSMIFSDLPSPAEAGFAQAGNRLPLFGIML
Ga0209577_104119082	3300026552	Soil	MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIMR
Ga0209577_104317062	3300026552	Soil	MIFSDLPSPAEASSQMTPSAKGFAQAGNRYPLFGIMSEAYSTQGVRL
Ga0209902_1036723	3300026863	Cyanobacterial	MIFSDLPSPAEALPTQKRLSKGSAQAGNRLPLLGIML
Ga0207834_10257961	3300026988	Tropical Forest Soil	LLQLFVLSMIFSDLASPAVASTERLGRLHGFAQAGNRYPLFGIML
Ga0209166_102718652	3300027857	Surface Soil	MIFSDLPSPAEASGRMEGLCGGFAQAGNRFPLFRIMLYDRQ
Ga0209579_104040101	3300027869	Surface Soil	TCSDLPSPAEASSQDDQLCQGFAQAGNRHPLFGVML
Ga0209465_101160471	3300027874	Tropical Forest Soil	MIFSDLPSPAEASSETTTRNRGFAQAGNRFPPRIK
Ga0209465_104961342	3300027874	Tropical Forest Soil	MIYSDLPSPAEASSHTTDCAKGFAQVGNRHPLFGIML
Ga0209380_101234712	3300027889	Soil	MIFSDLPSPAEASSQTDQRRQGFAQAGNRYPLFGIML
Ga0209067_109323091	3300027898	Watersheds	LSMIFSDLTSPAEASNETANGWRGFAQAGNRRPLFGIMR
Ga0307317_101572632	3300028720	Soil	MIFSDLPSPAEAPIHPRETMLGFAQAGNRRLLFGIMLY
Ga0307310_106456701	3300028824	Soil	IFSDLPTPAEASVHEVGRREGFAQAGNRFPLFGIMRL
Ga0308309_106296182	3300028906	Soil	MIFSDLASPAEAGFAKAGNRYPLFGIMLCRSVEHRR
Ga0308309_111363701	3300028906	Soil	DLPDLPSPAEASNESTRDWLGFAQAGNRYPLFGIML
Ga0308309_116484262	3300028906	Soil	MTFLRIVIPLYLIGWSMIFSDLPSPAEAGFAQAGNRCPLFGIML
Ga0222749_101662911	3300029636	Soil	LEHDFSDLPSATEASSQATKRAKGFAQAGNQYSLFG
Ga0170834_1045484384	3300031057	Forest Soil	AFCLSMIFSDLASPAEASNERASDCRGFAQAGNRHPLFGIKP
Ga0170823_159512381	3300031128	Forest Soil	PYHFCLRMIFSDLPSPAEASKERTRDCLGFAQAGNRLPLFGIMR
Ga0307497_101709332	3300031226	Soil	MRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLFGIMR
Ga0170820_112429083	3300031446	Forest Soil	MIFSDLASPAEALDETISRLHGFAQAGNRRPLFGIML
Ga0170820_150653833	3300031446	Forest Soil	MFPLFRIMQFWWSMIFSDLPSPAEASNETTNWCLGFAQAGNRLPLFRIML
Ga0318516_107800412	3300031543	Soil	MIFSDLASPAEASSETTKPDKGFAQAGNRFPLFGIML
Ga0318534_105387182	3300031544	Soil	MIFSDLASPAGALTEWAGRWQGFAQAGNRYPLFGIVL
Ga0318541_100396691	3300031545	Soil	MIFSDLASPAGALTEWAGRWQGFAQAGNRYPLFGI
Ga0310887_107800362	3300031547	Soil	MILSDLPTPAEASARVTGPREGFAQAGNRFTLFGIIRL
Ga0318573_107340231	3300031564	Soil	SPHSYWWSMIFSDLPSPAEASTHTTDRAKGFAQAGNRSPLFGIML
Ga0318560_100843491	3300031682	Soil	MIFSDLASPAEASSETTKPDKGFAQAGNRFPLFGIMR
Ga0265314_1000529912	3300031711	Rhizosphere	MIFSDLPSPAEASSNTKSLGKGFAQAGNRCTLFGIMH
Ga0307476_106767401	3300031715	Hardwood Forest Soil	WSMIFSDLPSPAEASSQNNRPCQGFAQAGNRCPLFGIML
Ga0307476_107648691	3300031715	Hardwood Forest Soil	AVLYCWSMIFSNLPSPAEASSQNDQPCQGFAQAGNRCPLFGIML
Ga0307474_110783601	3300031718	Hardwood Forest Soil	YWWSMIFSDLPSPAEASSQNNRPCQGFAQAGNRCPLFGIML
Ga0307469_112346811	3300031720	Hardwood Forest Soil	MICSDLPSPAEASGHTTGLCKGVAQPGNRYALFGIML
Ga0307469_119191282	3300031720	Hardwood Forest Soil	MMFSDLPSPAEASSQMKNRAKGFAQAGNQYPLFGIML
Ga0307516_107619311	3300031730	Ectomycorrhiza	VFSDLPSPAEASVRTMGPSQGFAQAGNRCTLFGIMF
Ga0306918_113383551	3300031744	Soil	LWSMTLSDLPSPAEASNDQTATWLGFAQAENRYPLFGVML
Ga0307477_103908643	3300031753	Hardwood Forest Soil	HCWSMIFSDLPSPAEASSQVTTGATGFAQAGNRYPLFGIMLY
Ga0307477_107998741	3300031753	Hardwood Forest Soil	MILTDPASLASPAEASTAITSRWHGFAQAGNRHPLFGIMLGS
Ga0318554_105857792	3300031765	Soil	DYVLRMIFSDRASPAEAPSHTTNRTKCFAQAGNRYPLFGIMR
Ga0318509_104523112	3300031768	Soil	YVLRMIFSDRASPAEAPSHTTNRTKCFAQAGNRYPLFGIMR
Ga0318509_104914781	3300031768	Soil	MIFSDLPSPAEASSHTTDRAKGFAQAGNRCPLFGIML
Ga0318552_105263541	3300031782	Soil	LFVLSMIFSNLASPAVTSTERLGRLHGFAQAGNRYPLFGIML
Ga0318550_101293202	3300031797	Soil	MIFSDLASPAEASSETTKPDKGFAQAGNRFPLFGIM
Ga0307473_114480761	3300031820	Hardwood Forest Soil	YWRMILSDLPSPAEASSHTTTSASGFAQAGNRFPLFGIMR
Ga0307478_104656321	3300031823	Hardwood Forest Soil	MIFSELPSPAEASSQNNQPCQGFAQAGNRYPLFGI
Ga0307478_105957691	3300031823	Hardwood Forest Soil	WWSMIFSDLPSPAEASSQNNRPCQGFAQAGNRCPLFGIML
Ga0307478_115476692	3300031823	Hardwood Forest Soil	MIFSDLPSPAEASSQNDQPCQGFAQAGNRYPLFGI
Ga0318511_104394772	3300031845	Soil	VLSMIFSELASPAAASTERLGRLHGFAQAGNRYPLFGIML
Ga0310904_106343181	3300031854	Soil	MILSDLPTPAEASARVTGPREGFAQAGNRFTLFGIIRLVTCAAKQA
Ga0310892_112904341	3300031858	Soil	ALCLSMIFSDLASPPEASSQTNFGGQGFAQAGNRFSLFGIML
Ga0306919_112061371	3300031879	Soil	MIFSDLPSPAEASSLTTDRAKGFAQAGNRRPLFRIMLLPIS
Ga0306925_119489661	3300031890	Soil	MIFSDLASPAGALTEWAGRWQGFAQAGTRYPLFGIVLGALSAGGRSS
Ga0306921_108312752	3300031912	Soil	MIFSDLPSPAEASTHTTDRAKGFAQAGNRYPLFGIML
Ga0306921_117517751	3300031912	Soil	MIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGIML
Ga0310912_112035291	3300031941	Soil	AFCLSMTLSDLASPAEASNGRNRDWRGFAQAGNRFSVFGIML
Ga0306926_113609572	3300031954	Soil	MILSDLPSPAEAPRHSSRYRLGFAQAGNRYPLSGIMLEHDR
Ga0318530_102152192	3300031959	Soil	VLLQLFVLSMIFSDLASPAAASTERLGRLHGFAQAGNRYPLFGIML
Ga0318559_104608972	3300032039	Soil	MIFSDLPSLAEASSHWDGLRQGFAQAGNRRPLFGIML
Ga0318533_107905541	3300032059	Soil	SMTLSDLPSPAEASNDQTATWLGFAQAENRYPLFGVML
Ga0318533_108017562	3300032059	Soil	MILSDLPSPAEAPRHSSRYRLGFAQAGNRYPLFGIMLEHDR
Ga0318553_106313022	3300032068	Soil	MIFSDLPSPAEASSHTTDRAKGFAQAGNRHPLFGIML
Ga0306924_122399252	3300032076	Soil	MIFSDLPSPAEASTHTTDRAKGFAQAGNRYPLFGIMLY
Ga0307470_101127092	3300032174	Hardwood Forest Soil	MIFSDLPSPTEASGHTTGLCKGVAQAGNRYALFGIML
Ga0307470_118535451	3300032174	Hardwood Forest Soil	MIFSDLPSPAEASSRAEGLKGFAQAGNRCTLFRIMRSERAADR
Ga0307472_1004797272	3300032205	Hardwood Forest Soil	MIFSDLPSPAEAASKTTTGATGFAQAGNRFPLFGIML
Ga0307472_1012466472	3300032205	Hardwood Forest Soil	MIFSDLPSPAEAASQTTSGATGFAQAGNRFPLFGIMR
Ga0307472_1020258902	3300032205	Hardwood Forest Soil	MIISDLPSPAEAPSQTTDRERGFAQAGNRFPLFGIML
Ga0306920_1021388391	3300032261	Soil	MIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGI
Ga0335081_1000084528	3300032892	Soil	MIFSDLPSPAEAPTQVINGSQGFAQAANRCTLFAIML
Ga0335081_107012642	3300032892	Soil	MIFSDLPSPAEASSNTKNLTKGFAQAGNRFPLFGIMREHHAPAP
Ga0335083_114066952	3300032954	Soil	MIFSDLASPAEAGFAKAGNRFPLFRIMLAIQAIRQMTKAR
Ga0335084_114348612	3300033004	Soil	MIFSGQASPAEAFFHIEGVRPGFAQAGNRYPLFGIML
Ga0335077_107682102	3300033158	Soil	MILSDLPSPAEASSQTKKSAKGFAQAENRFPLFGIML
Ga0335077_108762792	3300033158	Soil	MIFSDLASPAEAPSHTTVRAMGFAQAGNRFPLFGIML
Ga0335077_111523562	3300033158	Soil	MIFSGPPSPAEASLGMSSRAAGFAQAGNQYPLFGIMF
Ga0310914_100458083	3300033289	Soil	MIVSDLPSSAEAGNEDAGGWHGFAQAGNRLPLFGIML
Ga0247829_105083012	3300033550	Soil	MSCSDLPSHAENQNNDPCQGFAQAGNRFSLFRDMR
Ga0370498_066558_659_772	3300034155	Untreated Peat Soil	MILSDLPTPAEAFVNEIGRHQGFAQAGNRFPLFGIML
Ga0370498_134200_11_124	3300034155	Untreated Peat Soil	MILSDLPSPAEASSHNNDPCQGFAQAGNRIPLFGIML