NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025329

3300025329: Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-G (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025329 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0084162 | Gp0116218 | Ga0209072
Sample NameArctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-G (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6261842
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameArctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)polar biomepeatlandpeat soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Barrow Environmental Observatory site, Alaska
CoordinatesLat. (o)71.299Long. (o)-156.61Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003758Metagenome / Metatranscriptome470Y
F034279Metagenome / Metatranscriptome175Y
F102122Metagenome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209072_100419Not Available601Open in IMG/M
Ga0209072_100505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
Ga0209072_100857Not Available513Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209072_100419Ga0209072_1004191F003758GTDVEIGKKAIKHISFDPRMSPNVMRAFENAEDEVLMNTLKGAARLDVPSLFRPKFMAEVETEHPEYFADLPKLK
Ga0209072_100505Ga0209072_1005051F034279DLERAREAGATGYVSKDRIAAELVEAIREAAAADSSLS
Ga0209072_100857Ga0209072_1008571F102122MVRAKGRNHPYLELEGEALDNHMMAMHGWSMQMVAVKGTQTLAQKYNYIGDMHRREHHLPPHAVPVDED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.