| Basic Information | |
|---|---|
| Family ID | F034279 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 175 |
| Average Sequence Length | 39 residues |
| Representative Sequence | SRSDVDRAREAGAAGYVTKDRIAAELIEAIVEVAPR |
| Number of Associated Samples | 157 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.49 % |
| % of genes near scaffold ends (potentially truncated) | 92.57 % |
| % of genes from short scaffolds (< 2000 bps) | 93.14 % |
| Associated GOLD sequencing projects | 154 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.714 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.286 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF03840 | SecG | 82.29 |
| PF01726 | LexA_DNA_bind | 5.71 |
| PF01523 | PmbA_TldD | 1.71 |
| PF00072 | Response_reg | 1.14 |
| PF15515 | MvaI_BcnI | 0.57 |
| PF13302 | Acetyltransf_3 | 0.57 |
| PF01609 | DDE_Tnp_1 | 0.57 |
| PF13384 | HTH_23 | 0.57 |
| PF06762 | LMF1 | 0.57 |
| PF00534 | Glycos_transf_1 | 0.57 |
| PF10400 | Vir_act_alpha_C | 0.57 |
| PF04075 | F420H2_quin_red | 0.57 |
| PF12681 | Glyoxalase_2 | 0.57 |
| PF00903 | Glyoxalase | 0.57 |
| PF01872 | RibD_C | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG1314 | Protein translocase subunit SecG | Intracellular trafficking, secretion, and vesicular transport [U] | 82.29 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 1.71 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.57 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.57 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.57 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.57 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.57 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.71 % |
| Unclassified | root | N/A | 14.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02IV4V2 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300000890|JGI11643J12802_11883053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300000891|JGI10214J12806_11183544 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300001867|JGI12627J18819_10210950 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300002066|JGIcombinedJ21911_10111601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 803 | Open in IMG/M |
| 3300002075|JGI24738J21930_10140943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 532 | Open in IMG/M |
| 3300002076|JGI24749J21850_1066352 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300004633|Ga0066395_10317322 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300005093|Ga0062594_103170343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 515 | Open in IMG/M |
| 3300005345|Ga0070692_10234684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1091 | Open in IMG/M |
| 3300005444|Ga0070694_100847783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300005518|Ga0070699_100855106 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300005543|Ga0070672_100148201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1940 | Open in IMG/M |
| 3300005546|Ga0070696_100703939 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005547|Ga0070693_101063644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 615 | Open in IMG/M |
| 3300005559|Ga0066700_10519082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 831 | Open in IMG/M |
| 3300005566|Ga0066693_10394066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 562 | Open in IMG/M |
| 3300005568|Ga0066703_10461593 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005575|Ga0066702_10589570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300005578|Ga0068854_101743311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 570 | Open in IMG/M |
| 3300005586|Ga0066691_10892392 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005598|Ga0066706_11037334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 630 | Open in IMG/M |
| 3300005719|Ga0068861_100868220 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300005764|Ga0066903_105352363 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005886|Ga0075286_1069284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 515 | Open in IMG/M |
| 3300005889|Ga0075290_1034829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 660 | Open in IMG/M |
| 3300005893|Ga0075278_1013201 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300005896|Ga0075282_1006568 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300006046|Ga0066652_100691371 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300006046|Ga0066652_100772107 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300006046|Ga0066652_101919041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300006049|Ga0075417_10529352 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006175|Ga0070712_100140361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1843 | Open in IMG/M |
| 3300006175|Ga0070712_101288202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300006574|Ga0074056_11313831 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300006575|Ga0074053_11543257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300006791|Ga0066653_10139251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1165 | Open in IMG/M |
| 3300006794|Ga0066658_10115401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1300 | Open in IMG/M |
| 3300006794|Ga0066658_10932713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300006796|Ga0066665_11345060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300006806|Ga0079220_12154624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 500 | Open in IMG/M |
| 3300006844|Ga0075428_101401914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 733 | Open in IMG/M |
| 3300006847|Ga0075431_100145252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2445 | Open in IMG/M |
| 3300006871|Ga0075434_102262685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300006894|Ga0079215_11615162 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006903|Ga0075426_10926769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 657 | Open in IMG/M |
| 3300006914|Ga0075436_100983675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 633 | Open in IMG/M |
| 3300009012|Ga0066710_102409133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
| 3300009094|Ga0111539_12462071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300009148|Ga0105243_13067895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300009176|Ga0105242_12010716 | Not Available | 620 | Open in IMG/M |
| 3300009792|Ga0126374_11029419 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300009840|Ga0126313_10405284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1082 | Open in IMG/M |
| 3300010041|Ga0126312_10628133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 773 | Open in IMG/M |
| 3300010043|Ga0126380_12290686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300010152|Ga0126318_10812724 | Not Available | 552 | Open in IMG/M |
| 3300010301|Ga0134070_10389533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
| 3300010321|Ga0134067_10445791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300010322|Ga0134084_10230911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 660 | Open in IMG/M |
| 3300010325|Ga0134064_10074951 | Not Available | 1076 | Open in IMG/M |
| 3300010325|Ga0134064_10235217 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300010329|Ga0134111_10142875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 943 | Open in IMG/M |
| 3300010336|Ga0134071_10667957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300010362|Ga0126377_13018648 | Not Available | 543 | Open in IMG/M |
| 3300010366|Ga0126379_11834406 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300010375|Ga0105239_12996446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300010375|Ga0105239_13472287 | Not Available | 512 | Open in IMG/M |
| 3300010399|Ga0134127_10261201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1647 | Open in IMG/M |
| 3300010400|Ga0134122_12399078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300010401|Ga0134121_11693811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
| 3300012014|Ga0120159_1126834 | Not Available | 713 | Open in IMG/M |
| 3300012200|Ga0137382_10245758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1239 | Open in IMG/M |
| 3300012200|Ga0137382_10504075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 860 | Open in IMG/M |
| 3300012204|Ga0137374_10159752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1999 | Open in IMG/M |
| 3300012204|Ga0137374_10188654 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300012209|Ga0137379_10363538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1356 | Open in IMG/M |
| 3300012210|Ga0137378_11808213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300012211|Ga0137377_11214648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300012211|Ga0137377_11259996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300012212|Ga0150985_107073061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300012212|Ga0150985_113286454 | Not Available | 515 | Open in IMG/M |
| 3300012285|Ga0137370_10931750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300012349|Ga0137387_11105445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300012350|Ga0137372_10408921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1026 | Open in IMG/M |
| 3300012355|Ga0137369_10485632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
| 3300012356|Ga0137371_10018208 | All Organisms → cellular organisms → Bacteria | 5397 | Open in IMG/M |
| 3300012360|Ga0137375_10765528 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300012360|Ga0137375_11249719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300012519|Ga0157352_1061537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300012532|Ga0137373_10660658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
| 3300012882|Ga0157304_1042870 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012951|Ga0164300_10025992 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
| 3300012960|Ga0164301_10514894 | Not Available | 866 | Open in IMG/M |
| 3300012960|Ga0164301_10515621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
| 3300012960|Ga0164301_11440969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300012960|Ga0164301_11875196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300012977|Ga0134087_10151786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1009 | Open in IMG/M |
| 3300012986|Ga0164304_10581270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
| 3300012989|Ga0164305_10019407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3504 | Open in IMG/M |
| 3300013296|Ga0157374_12377943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300013770|Ga0120123_1040001 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300014254|Ga0075312_1151994 | Not Available | 514 | Open in IMG/M |
| 3300014325|Ga0163163_12800978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300014326|Ga0157380_13221561 | Not Available | 521 | Open in IMG/M |
| 3300014501|Ga0182024_12254165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300015077|Ga0173483_10860973 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300015358|Ga0134089_10114742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1042 | Open in IMG/M |
| 3300015359|Ga0134085_10557158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300015374|Ga0132255_102608740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300018061|Ga0184619_10145642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1080 | Open in IMG/M |
| 3300018431|Ga0066655_10540795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300018482|Ga0066669_11310527 | Not Available | 655 | Open in IMG/M |
| 3300019767|Ga0190267_11075906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300020170|Ga0179594_10160508 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300021080|Ga0210382_10334927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
| 3300022467|Ga0224712_10668017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300023168|Ga0247748_1087125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300024219|Ga0247665_1059765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300024232|Ga0247664_1142317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300024251|Ga0247679_1027363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 963 | Open in IMG/M |
| 3300025329|Ga0209072_100505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300025903|Ga0207680_10878872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300025903|Ga0207680_11233080 | Not Available | 533 | Open in IMG/M |
| 3300025910|Ga0207684_10827764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300025921|Ga0207652_11805154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300025928|Ga0207700_10781642 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300025931|Ga0207644_11550993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300025937|Ga0207669_10116985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1800 | Open in IMG/M |
| 3300025960|Ga0207651_10237787 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300025972|Ga0207668_10390679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1174 | Open in IMG/M |
| 3300025981|Ga0207640_11675601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300026008|Ga0208529_1019746 | Not Available | 632 | Open in IMG/M |
| 3300026014|Ga0208776_1024808 | Not Available | 515 | Open in IMG/M |
| 3300026116|Ga0207674_11515397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300026121|Ga0207683_10748240 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300026298|Ga0209236_1221712 | Not Available | 660 | Open in IMG/M |
| 3300026327|Ga0209266_1206230 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300026343|Ga0209159_1264969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300026524|Ga0209690_1189228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
| 3300026542|Ga0209805_1332323 | Not Available | 577 | Open in IMG/M |
| 3300027882|Ga0209590_10130909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1536 | Open in IMG/M |
| 3300028145|Ga0247663_1092569 | Not Available | 547 | Open in IMG/M |
| 3300028563|Ga0265319_1049462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1392 | Open in IMG/M |
| 3300028589|Ga0247818_10242011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1191 | Open in IMG/M |
| 3300028714|Ga0307309_10002274 | All Organisms → cellular organisms → Bacteria | 2907 | Open in IMG/M |
| 3300028720|Ga0307317_10259570 | Not Available | 587 | Open in IMG/M |
| 3300028754|Ga0307297_10013469 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
| 3300028754|Ga0307297_10309950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300028778|Ga0307288_10296334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300028787|Ga0307323_10077110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1187 | Open in IMG/M |
| 3300028799|Ga0307284_10218401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
| 3300028810|Ga0307294_10045453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1261 | Open in IMG/M |
| 3300028812|Ga0247825_10526540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300028814|Ga0307302_10252402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300028814|Ga0307302_10321845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
| 3300028876|Ga0307286_10003539 | All Organisms → cellular organisms → Bacteria | 4611 | Open in IMG/M |
| 3300028876|Ga0307286_10044244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1498 | Open in IMG/M |
| 3300028878|Ga0307278_10074421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1531 | Open in IMG/M |
| 3300029957|Ga0265324_10268509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300031226|Ga0307497_10009932 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
| 3300031421|Ga0308194_10234720 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031670|Ga0307374_10127522 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300031672|Ga0307373_10332090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 937 | Open in IMG/M |
| 3300031893|Ga0318536_10374627 | Not Available | 720 | Open in IMG/M |
| 3300031954|Ga0306926_11512719 | Not Available | 774 | Open in IMG/M |
| 3300031995|Ga0307409_102070672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 599 | Open in IMG/M |
| 3300031996|Ga0308176_12142669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300032001|Ga0306922_12072037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300032090|Ga0318518_10622475 | Not Available | 550 | Open in IMG/M |
| 3300032174|Ga0307470_11926179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300032421|Ga0310812_10393372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300033233|Ga0334722_10281288 | Not Available | 1216 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.43% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.29% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.14% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.14% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.14% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.14% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.14% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.57% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.57% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.57% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.57% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.57% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.57% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002066 | Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004) | Environmental | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025329 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-G (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026008 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 (SPAdes) | Environmental | Open in IMG/M |
| 3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_11714680 | 2170459005 | Grass Soil | SNARADVDRAREAGAAGYLTKDRVAAELISAIVEVAAR |
| JGI11643J12802_118830532 | 3300000890 | Soil | RTDVARARDAGAAAYVTKDRIAAHLIDAIRELAA* |
| JGI10214J12806_111835441 | 3300000891 | Soil | AADVDRARDAGAAGYVTKDRIASQLVEAIVEAAGR* |
| JGI12627J18819_102109501 | 3300001867 | Forest Soil | GSNLRGDVDRARKAGAAGYVTKDRIAAELVDAILKVAPS* |
| JGIcombinedJ21911_101116011 | 3300002066 | Arctic Peat Soil | SSRADVDLAREAGAAGYVTKDRIAAELIAAIVEIATT* |
| JGI24738J21930_101409431 | 3300002075 | Corn Rhizosphere | GSNARADVARARDAGAAAYVTKDRIAAQLVDAIRELAVG* |
| JGI24749J21850_10663521 | 3300002076 | Corn, Switchgrass And Miscanthus Rhizosphere | TDVDQARQAGAAGYVTKDRIAAELIEAIVEVVPR* |
| Ga0066395_103173221 | 3300004633 | Tropical Forest Soil | SRADVDRSRDAGASGYVTKDRIASELVEAIVEVTRGRLP* |
| Ga0062594_1031703432 | 3300005093 | Soil | QWPTACVLVLTGSNSRSDVDRARDAGAAGYVTKERIAAELIDAILEIGSR* |
| Ga0070692_102346841 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | TGSNSLTDVARAREAGAAGYVTKDRIAAQLIDAIRELAA* |
| Ga0070694_1008477831 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | QVLMVTGSDSREDVDAARSAGAAGYVTKDRIAGELIGAIFDASR* |
| Ga0070699_1008551063 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LTGSNSKSDVDRAHAAGAAGYVTKERIAAELIDAILELAGR* |
| Ga0070672_1001482014 | 3300005543 | Miscanthus Rhizosphere | SLSDVARAREAGAAGYVTKDRIAAQLIDAIRELAA* |
| Ga0070696_1007039391 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GSNSRADVDRSREAGASGYITKDRIASELVAAIVEVSRRRLP* |
| Ga0070693_1010636441 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LTGSNSRKDVDRARDAGAAGYVTKERIAAELIDAILEIGSR* |
| Ga0066700_105190823 | 3300005559 | Soil | RADVDRARQAGAAGYVTKDRIAAELIDAILEVVAR* |
| Ga0066693_103940661 | 3300005566 | Soil | SNSRLDVVRAREVGAAGYVTKERIAAELIDAILEIGSR* |
| Ga0066703_104615934 | 3300005568 | Soil | TGSNARTDVDRARQAGADGYVTKDRIAAELVEAILEVAQR* |
| Ga0066702_105895704 | 3300005575 | Soil | SNSRADVDRSREAGASGYVTKDRIASELIATIVEVTHRRLP* |
| Ga0068854_1017433111 | 3300005578 | Corn Rhizosphere | RVLMVTGSDARQDVDAARTAGAAGYVTKDKIAAELIGAILDTAA* |
| Ga0066691_108923921 | 3300005586 | Soil | KTDVDRARESGAAGYVTKDRIAAELIEAILEVVQR* |
| Ga0066706_110373343 | 3300005598 | Soil | TGSNSRADVDRARKAGAAGYVTKDRIAAELVEAILEVAER* |
| Ga0068859_1014476563 | 3300005617 | Switchgrass Rhizosphere | GSDDPADIAKAREAGAAGYITKDRIAEQLVEAILEAVR* |
| Ga0068861_1008682201 | 3300005719 | Switchgrass Rhizosphere | LMVTGSDAQEDVEAARTAGAAGYMTKDRIAAELVVAILDVAA* |
| Ga0066903_1053523632 | 3300005764 | Tropical Forest Soil | LIVTGSDARQDVDAARTAGADGYVTKDRIAAELIGAIIGTTV* |
| Ga0075286_10692841 | 3300005886 | Rice Paddy Soil | MVTGSDARQDVGAARAAGAAGYVTKDRIAAELVGAILDVAA* |
| Ga0075290_10348291 | 3300005889 | Rice Paddy Soil | QVLMVTGSDARQDVGAARAAGAAGYVTKDRIAAELVGAILDVAA* |
| Ga0075278_10132014 | 3300005893 | Rice Paddy Soil | VRILVLTGSNSRDDVDRSREAGASGYVTKDRIASELVEAIVEVASR* |
| Ga0075282_10065681 | 3300005896 | Rice Paddy Soil | SRADVDRSREAGASGYVTKDRIASELVATIVEVTQRRLP* |
| Ga0066652_1006913713 | 3300006046 | Soil | SNSKTDVDRAREAGAAGYVTKERIAAELIDAILELANR* |
| Ga0066652_1007721073 | 3300006046 | Soil | TGSNSRTDVDRARQAGAAGYVTKDRIAAELIDAIVEIAGR* |
| Ga0066652_1019190411 | 3300006046 | Soil | SDVARAREAGASGYITKDKIASQLIETIVELGPRTNGT* |
| Ga0075417_105293523 | 3300006049 | Populus Rhizosphere | VDIDRARKAGAAGYVTKDRIASELIEAIREVIPE* |
| Ga0070712_1001403615 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ACILMLSGSSSRADVERARDAGVAGYVTKDRVASELIAAIVEIAKPT* |
| Ga0070712_1012882021 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTGSSSRTDVDRAREAGAAGYVTKERIAAELIDAIVEIGAR* |
| Ga0074056_113138313 | 3300006574 | Soil | ARVVMVTGSDAQEDVDAARGAGATGYLTKDRIAAELVVAILDAAE* |
| Ga0074053_115432572 | 3300006575 | Soil | QVLIVTGSDSRQDVDAARTAGAAGYVTKDKIAAELIGAILDTAA* |
| Ga0066653_101392513 | 3300006791 | Soil | LTGSNSRSDVDRAREAGAAGYVTKERIAAELIDAILEIGNP* |
| Ga0066658_101154011 | 3300006794 | Soil | SRADVDRSRAAGASGYVTKDRIASELVAAIVEVTQRRLP* |
| Ga0066658_109327133 | 3300006794 | Soil | ADVDRSREAGASGYVTKDRIASELVDAILEVTKR* |
| Ga0066665_113450601 | 3300006796 | Soil | AADIDRSRDAGAAGYVTKDRIASELVQAIVEAAGR* |
| Ga0079220_121546243 | 3300006806 | Agricultural Soil | LILTGSNAAVDVDRSREAGAAAYVTKDRIAAQLIEAIRELAA* |
| Ga0075428_1014019141 | 3300006844 | Populus Rhizosphere | QVDIDRARQAGAAGYVTKDRIASELIEAIREVIPE* |
| Ga0075431_1001452525 | 3300006847 | Populus Rhizosphere | SRSDVDRAREAGAAGYVTKDRIAAELIEAIVEVAPR* |
| Ga0075434_1022626853 | 3300006871 | Populus Rhizosphere | DSRSDVDRAREAGAAGYVTKDRIAAELIEAIVEVAPR* |
| Ga0079215_116151621 | 3300006894 | Agricultural Soil | RTDVDRAREAGAAGYVTKDRIAAELIDAILEVVQR* |
| Ga0075426_109267693 | 3300006903 | Populus Rhizosphere | NSLSDVARAREAGAAAYVTKDRIAAQLIDAIRELAA* |
| Ga0075436_1009836751 | 3300006914 | Populus Rhizosphere | LSDVARAREAGAAAYVTKDRIAAQLIDAIRELAA* |
| Ga0066710_1024091333 | 3300009012 | Grasslands Soil | DVARAREAGASAYVTKDKIASHLLDAIVELGPKPSGN |
| Ga0111539_124620712 | 3300009094 | Populus Rhizosphere | VRQDVDAARTAGAAGYVTKDRIAAELIGAIFEVADD* |
| Ga0105243_130678951 | 3300009148 | Miscanthus Rhizosphere | NARGDVDKARTSGAAGYVTKDRIAGELIDAIVEVVDK* |
| Ga0105242_120107163 | 3300009176 | Miscanthus Rhizosphere | SDIDKARRAGAAAYVTKDRIASELIEAIMEAVKR* |
| Ga0126374_110294191 | 3300009792 | Tropical Forest Soil | AAADVDSSRDAGAAGYVTKDRIASELVDAIVEAAGR* |
| Ga0126313_104052844 | 3300009840 | Serpentine Soil | DVERAEAAGAAGYLTKDRIASELVDAIHAAAKGG* |
| Ga0126312_106281333 | 3300010041 | Serpentine Soil | SRLDIDRARTSGAAGYVTKDRIALDLVAAIHHLVSTPE* |
| Ga0126380_122906863 | 3300010043 | Tropical Forest Soil | TGSNSRADVDRSREAGAAGYVTKDRIASELVDAILEVTGRRLP* |
| Ga0126318_108127243 | 3300010152 | Soil | DRSREAGASGYVTKDRIASELVATIVEVTRRRLP* |
| Ga0134070_103895331 | 3300010301 | Grasslands Soil | RDDVDRARKAGAGAYVTKDQIASQLIDAILDLAA* |
| Ga0134067_104457911 | 3300010321 | Grasslands Soil | TDIDRSRDAGAAGYVTKDRIASQLVEAIVEAAGR* |
| Ga0134084_102309113 | 3300010322 | Grasslands Soil | GSDSAADVARSRDAGAVGYVTKDRIAAELLEAIAEAAAA* |
| Ga0134064_100749511 | 3300010325 | Grasslands Soil | SRADVDRSREAGASGYVTKDRIASELVSAIVEVTRRRLP* |
| Ga0134064_102352173 | 3300010325 | Grasslands Soil | SRSDVDRAREAGAAGYVTKERIAAELIDAILEIGNR* |
| Ga0134111_101428751 | 3300010329 | Grasslands Soil | HACVLVLTGSNSRTDVTRARAAGAAGYVTKDRIAAELIDAIIEVVSK* |
| Ga0134071_106679571 | 3300010336 | Grasslands Soil | RTDVDLARKAGAAGYVTKDRIPAELIDAIVEVVNR* |
| Ga0126377_130186482 | 3300010362 | Tropical Forest Soil | SNSRADVDRARKAGASGYVTKDRIAAELIDAIVEIAER* |
| Ga0126379_118344063 | 3300010366 | Tropical Forest Soil | NTAADVDRSRDAGAAGYVTKDRIASELVDAIVEAAGR* |
| Ga0105239_129964461 | 3300010375 | Corn Rhizosphere | LMVTGSDAQEDVEAARTAGAAGYMTKDRIAAELVVAILDAAA* |
| Ga0105239_134722872 | 3300010375 | Corn Rhizosphere | MVTGSDAQEDVDAARGAGALGYVTKDRIAAELVVAILDVAA* |
| Ga0134127_102612011 | 3300010399 | Terrestrial Soil | LTGSNSRTDVARAREAGAAAYVTKDRIAAQLIEAIRELAA* |
| Ga0134122_123990781 | 3300010400 | Terrestrial Soil | QKKIRVLMVTGSDARQDVDAARTAGAAGYVTKDKIAAELIGAILDTAA* |
| Ga0134121_116938113 | 3300010401 | Terrestrial Soil | RGDVDEARKAGAAGYVTKDRIAAELVDAIIEIGSK* |
| Ga0120159_11268341 | 3300012014 | Permafrost | SRTDVSRSREAGADGYVTKDRVAAELIDAIIEVAER* |
| Ga0137382_102457583 | 3300012200 | Vadose Zone Soil | GSNSHNDIDRSRVSGAAGYVTKDLIASELIQAIVEAVP* |
| Ga0137382_105040751 | 3300012200 | Vadose Zone Soil | RGDVDRARKAGAGAYVTKDQIASQLIDAILDLAA* |
| Ga0137374_101597521 | 3300012204 | Vadose Zone Soil | TGSNSRTDVDRAREAGAAGYVTKDRIAAELIDAIIEVSEK* |
| Ga0137374_101886541 | 3300012204 | Vadose Zone Soil | DVDRARQAGAAGYITKDRIAAELIEAIVKVAPQSF* |
| Ga0137379_103635381 | 3300012209 | Vadose Zone Soil | MLTGSSAAADVARAREAGAEGYVTKDRIASELIDSIVSVTGK* |
| Ga0137378_118082133 | 3300012210 | Vadose Zone Soil | GSNSRSDVDRARNAGAAGYVTKDRIAAELIDAIVEVAGRR* |
| Ga0137377_112146481 | 3300012211 | Vadose Zone Soil | MLTGSDSRTDVERAREAGAAGYVTKNRIAAELIDAILEVVAR* |
| Ga0137377_112599963 | 3300012211 | Vadose Zone Soil | SNARTDVDRARKSGAAGYVTKDRIAAELIDAIVEVVSR* |
| Ga0150985_1070730612 | 3300012212 | Avena Fatua Rhizosphere | MLTGCNARNDVDRARQAGAAGYVTKDRIAAELIDAIVEISAAS* |
| Ga0150985_1132864543 | 3300012212 | Avena Fatua Rhizosphere | ATRVLILTGSNSRTDVDRSRAAGASGYVTKDRIAAELIEAIIEIASRS* |
| Ga0137370_109317501 | 3300012285 | Vadose Zone Soil | TGSNSTGDVARAREAGASAYVTKDKIASHLLDAIVELGIRPGGK* |
| Ga0137387_111054451 | 3300012349 | Vadose Zone Soil | KSDVDRAREAGAAGYVTKERIAAELIDAILEIATR* |
| Ga0137372_104089212 | 3300012350 | Vadose Zone Soil | GSNSRDDVDRARQAGAAGYVTKDRIAAQLVDTILAVARRNAA* |
| Ga0137369_104856321 | 3300012355 | Vadose Zone Soil | ASGEDVDRARRAGAAGYVTKDRIAAELVGAILGVAER* |
| Ga0137371_100182081 | 3300012356 | Vadose Zone Soil | DSRNDVDRAREAGAAGYVTKDRIAAEVIEAIVEIAPR* |
| Ga0137384_105405851 | 3300012357 | Vadose Zone Soil | SADVDRARRAGAAGYITKDRIASQLIEAIIEVVSGS* |
| Ga0137375_107655283 | 3300012360 | Vadose Zone Soil | TGSDAHQDVDAARSAGASGYVTKDRIGAELIGAILDVAV* |
| Ga0137375_112497193 | 3300012360 | Vadose Zone Soil | SNSRDDVGRAREAGASGYVTKERIAAELIDAILEIAAR* |
| Ga0157352_10615371 | 3300012519 | Unplanted Soil | GSNARTDIARAREAGASAYVTKDRIAAQLIEAIRELAA* |
| Ga0137373_106606583 | 3300012532 | Vadose Zone Soil | NSRDDVGRAREAGASGYVTKERIAAELIDAILEIAER* |
| Ga0157304_10428702 | 3300012882 | Soil | LRTPDQSRAELARAREAGAAAYVTKDRIAAQLIEAIRDLAA* |
| Ga0137396_111012411 | 3300012918 | Vadose Zone Soil | DPADIAKARDAGAAGYITKDRIAERLVEAILDAAELP* |
| Ga0164300_100259921 | 3300012951 | Soil | TAVDIDRARGAGAAGYITKDRIASQLVEAIVETAGR* |
| Ga0164301_105148941 | 3300012960 | Soil | MLTGSNSRADVDRSRAAGASGYVTKDRIASELVATIVEVTRRRLP* |
| Ga0164301_105156211 | 3300012960 | Soil | TGSNSLTDVARAREAGAAGYVTKDRIAAPLIDAIRELAA* |
| Ga0164301_114409693 | 3300012960 | Soil | VLTGSNSRLDVVRAREVGAAGYVTKERIAAELIDAILEIGSR* |
| Ga0164301_118751963 | 3300012960 | Soil | SDASEDVDAARSAGAAGYVTKDKIAAELIGAIFDASR* |
| Ga0134087_101517864 | 3300012977 | Grasslands Soil | VDRSREAGASGYVTKDRIASELVSAIVEVTRRRLP* |
| Ga0164304_105812703 | 3300012986 | Soil | SRIDVDRAREAGAAGYVTKDRIAAELIDAILEVAR* |
| Ga0164305_100194077 | 3300012989 | Soil | RADVDRSRAVGAVGYVTKDRIASELVDAILEVRGRRLP* |
| Ga0157374_123779431 | 3300013296 | Miscanthus Rhizosphere | GSNSRADVDRSRDAGASGYVTKDRIASELVAAIVEVRRRRLP* |
| Ga0120123_10400012 | 3300013770 | Permafrost | LRRSNSRADVARARAAGASAYVTKDRIAAQLIDAIRELAAA* |
| Ga0075312_11519943 | 3300014254 | Natural And Restored Wetlands | VAAARDAGGSGYVTKDKIASELVDAIRAAAPSCA* |
| Ga0163163_128009781 | 3300014325 | Switchgrass Rhizosphere | TGSNSRGDVDKARTSGAAGYVTKDRIAGELIDAIVELVDK* |
| Ga0157380_132215611 | 3300014326 | Switchgrass Rhizosphere | DAQEDVDAARGAGALGYVTKDRIAAELVVAILDVAA* |
| Ga0182024_122541653 | 3300014501 | Permafrost | SNARTDVDRARQAGAAGYVTKDRIAAELVEAILEVADR* |
| Ga0173483_108609732 | 3300015077 | Soil | GSNSRGDVDRARTSGAAGYVTKDRIAGELIDAIVGVVNR* |
| Ga0134089_101147421 | 3300015358 | Grasslands Soil | MLTASNSRTDLDRAREAGAAGYVTKDRIAAELIDAILEVVAP* |
| Ga0134085_105571582 | 3300015359 | Grasslands Soil | SRSDVDRARKAGAAGYVTKDRIAAELIDAIVEISARR* |
| Ga0132255_1026087403 | 3300015374 | Arabidopsis Rhizosphere | VDAARGAGATGYLTKDRIAAELVVAILDAAAQPLR* |
| Ga0184619_101456423 | 3300018061 | Groundwater Sediment | TGSNARADVARARDAGAAGYVTKDRIAAQLIEAIRELGKD |
| Ga0066655_105407951 | 3300018431 | Grasslands Soil | RTDVDRARQAGAAGYVTKDRIAAELVEAILEVAGR |
| Ga0066669_113105271 | 3300018482 | Grasslands Soil | LTGSNSRADVDRSREAGASGYVTKDRIASELVSAIVEVTRRRLP |
| Ga0190267_110759061 | 3300019767 | Soil | RTDVARAREAGAAAYITKDRIAAQLIEAIRELGAN |
| Ga0179594_101605083 | 3300020170 | Vadose Zone Soil | AAADVDRSRDAGAAGYVTKDRIASQLVEAIVEAAGR |
| Ga0210382_103349271 | 3300021080 | Groundwater Sediment | TGSNSRIDVDRAREAGAAGYVTKDRIAAELIDAILEVAS |
| Ga0224712_106680172 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VPAARRSSSRADVDRSREAGASGYVTKDRIASELVAAIVEVTHRRLP |
| Ga0247748_10871253 | 3300023168 | Soil | SNSRTDVARAREAGAAAYVTKDRIAAQLIEAIRDLAA |
| Ga0247665_10597653 | 3300024219 | Soil | SNSRTDVARAREAGAAAYVTKDRIAAQLIEAIRELAA |
| Ga0247664_11423171 | 3300024232 | Soil | DSREDVDAARSAGAAGYVTKDKIAAELIGAIFDVSR |
| Ga0247679_10273631 | 3300024251 | Soil | SRTDVARAREAGAAAYVTKDRIAAQLIEAIRELAA |
| Ga0209072_1005051 | 3300025329 | Arctic Peat Soil | DLERAREAGATGYVSKDRIAAELVEAIREAAAADSSLS |
| Ga0207680_108788723 | 3300025903 | Switchgrass Rhizosphere | SLTDVARAREAGAAAYVTKDRIAAQLIDAIRELAA |
| Ga0207680_112330803 | 3300025903 | Switchgrass Rhizosphere | PVLGHVADVDRARQAGAAGYVTKDRIAAELIDAIIEIAGR |
| Ga0207684_108277641 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AADVDRSRDAGAAGYITKDRIASQLVEAIVEAASR |
| Ga0207652_118051541 | 3300025921 | Corn Rhizosphere | RGDVDRARQAGAAGYVTKDRIASELIDAIVEIVSR |
| Ga0207700_107816423 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TGSNAAADVDRARDAGAAGYVTKDRIASQLVEAIVEAAGR |
| Ga0207644_115509932 | 3300025931 | Switchgrass Rhizosphere | SDARADVDRARQAGASGYVTKDRIAAELIDAIVSAAGR |
| Ga0207669_101169854 | 3300025937 | Miscanthus Rhizosphere | SNSRTDVDQARQAGDAGYVTKDRIAAELIEAIVEVVPR |
| Ga0207651_102377872 | 3300025960 | Switchgrass Rhizosphere | MVTGSDAQEDVEAARTAGAAGYMTKDRIAAELVVAILDAAA |
| Ga0207668_103906792 | 3300025972 | Switchgrass Rhizosphere | MVTGSDARQDVDAARTAGAAGYVTKDKIAAELIGAILDTAA |
| Ga0207640_116756011 | 3300025981 | Corn Rhizosphere | SNSRTDVDRVREAGAAGYVTKERIAAELIDAILEIGAR |
| Ga0208529_10197462 | 3300026008 | Rice Paddy Soil | SGLKVSILVLTGSNSRDDVDRSRAAGASGYVTKDRIASELVEAIVEVATR |
| Ga0208776_10248081 | 3300026014 | Rice Paddy Soil | MVTGSDARQDVGAARAAGAAGYVTKDRIAAELVGAILDVAA |
| Ga0207674_115153971 | 3300026116 | Corn Rhizosphere | SRIDVDRAREAGAAGYVTKDRIAAELIDAILEVAP |
| Ga0207683_107482403 | 3300026121 | Miscanthus Rhizosphere | SDARQDFDAARAAGAAGYVTKDKIAAELIGAIIDLAE |
| Ga0209236_12217121 | 3300026298 | Grasslands Soil | SNSRADVDRSREAGASGYVTKDRIASELVSAIVEVTRRRLP |
| Ga0209266_12062301 | 3300026327 | Soil | SNAAADVDRARDAGAAGYVTKDRIASQLVEAIVEAAGR |
| Ga0209159_12649691 | 3300026343 | Soil | RMLTGSNATGDVARAREAGASAYVTKDKIASQLIDTIVELGSRMNGK |
| Ga0209690_11892283 | 3300026524 | Soil | AADVDRARDAGAAGYVTKDRIASQLVEAIVEAAGR |
| Ga0209805_13323233 | 3300026542 | Soil | TGSNSRDDVDRARKAGASGYVTKDRIAAELIEAIVEIASRS |
| Ga0209590_101309093 | 3300027882 | Vadose Zone Soil | SNSRSDVDRARKAGAAGYVTKDRIAAELIDAILEVVAR |
| Ga0247663_10925693 | 3300028145 | Soil | DAQEDVDAARGAGALGYVTKDRIAAELVVAILDVAA |
| Ga0265319_10494625 | 3300028563 | Rhizosphere | GSRVLIVTGSDARQDVDAARAAGAAGYVTKDRIAAELISVIIRVAA |
| Ga0247818_102420111 | 3300028589 | Soil | VTGSDSRQDVDAARSAGAAGYITKDKIAAELIGAILDTAA |
| Ga0307309_100022744 | 3300028714 | Soil | NAAVDVDRSRDAGAAGYVTKDRIASQLVDAIVDTAAR |
| Ga0307317_102595701 | 3300028720 | Soil | AQEDVEAARTAGASGYMTKDKIAAELVVAILDAAA |
| Ga0307297_100134691 | 3300028754 | Soil | GSNAAVDVDRSRDAGAAGYVTKDRIASQLVDAIVDTAAR |
| Ga0307297_103099503 | 3300028754 | Soil | SNARADVARARDAGAAAYVTKDRIAAQLIDAIRELATG |
| Ga0307288_102963343 | 3300028778 | Soil | GSSSSADVARAREAGVAGYVTKDRIASELIDSIVEAARKQA |
| Ga0307323_100771101 | 3300028787 | Soil | GSNSRIDVDRAREAGAAGYVTKNRIAAELIDAILEVAS |
| Ga0307284_102184013 | 3300028799 | Soil | MLTGSNSRSDVARAREAGAAAYVTKDRIAAQLIDAIRELAA |
| Ga0307294_100454533 | 3300028810 | Soil | SNSRSDVARAREAGAAAYVTKDRIAAQLIDAIRELAA |
| Ga0247825_105265403 | 3300028812 | Soil | ARSDVDRARRAGAAGYVTKDRIAAELIDAIIEVAGR |
| Ga0307302_102524023 | 3300028814 | Soil | SRIDVDRAREVGAAGYVTKDRIAAELIDAIVEVAS |
| Ga0307302_103218451 | 3300028814 | Soil | LTGSNSRSDVARAREAGAAAYVTKDRIAAQLIDAIRELAA |
| Ga0307286_100035397 | 3300028876 | Soil | NSRTDVDQAREAGAAGYVTKDRIAAELIDAILEVVPR |
| Ga0307286_100442441 | 3300028876 | Soil | GSNSRSDVARAREAGAAAYVTKDRIAAQLIDAIRELAA |
| Ga0307278_100744213 | 3300028878 | Soil | RTDVDRAREAGAAGYVTKERIAAELIDAILEIAAR |
| Ga0265324_102685091 | 3300029957 | Rhizosphere | NSRSDVDQAREAGASGYVTKDRIASELVEAIVKVAPR |
| Ga0307497_100099324 | 3300031226 | Soil | GSDSHQDVDAARSAGAAGYITKDRIAAELIGAIIDTAA |
| Ga0308194_102347201 | 3300031421 | Soil | GSNSRADVDRSREAGAVGYVTKDRIASELIEAILDVVKR |
| Ga0307374_101275226 | 3300031670 | Soil | TGSNSRGDVDRARKAGAAGYVTKDRIAAELIDAIVEIAQKT |
| Ga0307373_103320902 | 3300031672 | Soil | TGSNSRSDVDSAREAGASGYVTKDRIASELVEAIVEVAQST |
| Ga0318536_103746274 | 3300031893 | Soil | SNSRSDVDSAREAGASGYVTKDRIASELVEAIVEVAQQK |
| Ga0306926_115127191 | 3300031954 | Soil | NSRADVDRSREAGASGYVTKDRIASELVAAIVEVMQRRLP |
| Ga0307409_1020706723 | 3300031995 | Rhizosphere | ADEADVQRAAEAGAVGYVTKDRILSDLVEAIAAAAGAEGSLS |
| Ga0308176_121426691 | 3300031996 | Soil | TACVLVLTGSNSRSDVDRARDAGAAGYVTKERIAAELIDAIVEIGSR |
| Ga0306922_120720371 | 3300032001 | Soil | DRVRVLVLTGSNSRADVDRSRQAGASGYVTKDRIASELVESIVEVAGR |
| Ga0318518_106224751 | 3300032090 | Soil | SNSRDDVDRSREAGASGYVTKDRIASELVAAIVEVTRRRLP |
| Ga0307470_119261793 | 3300032174 | Hardwood Forest Soil | TGSDAQEDVDAARGAGATGYLTKDRIAAELVVAILDAAAQPLR |
| Ga0310812_103933721 | 3300032421 | Soil | AADVDRSRAVGAAGYITKDRIASQLVEAIVEAASR |
| Ga0334722_102812881 | 3300033233 | Sediment | RDDVDRARQAGAAGYVTKDRIAAELIEAIVEIASR |
| ⦗Top⦘ |