3300025199: Marine microbial communities from the Deep Pacific Ocean - MP1648 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300025199
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053074 | Gp0053866 | Ga0208331
• Sample Name: Marine microbial communities from the Deep Pacific Ocean - MP1648 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 69660325
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Ocean Microbial Communities From The Global Malaspina Expedition
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: North of Tokelau, South Pacific Ocean
• Coordinates
  • Lat. (^o): -5.74
  • Long. (^o): -170.77
  • Alt. (m): N/A
  • Depth (m): 4017.73

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001487	Metagenome	686	Y
F077438	Metagenome / Metatranscriptome	117	Y
F084703	Metagenome / Metatranscriptome	112	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0208331_105715	All Organisms → cellular organisms → Bacteria	1693
Ga0208331_122571	Not Available	568
Ga0208331_127165	Not Available	500

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208331_105715	Ga0208331_1057151	F077438	FTQSRFETLFLWNLQVEISAALRSMVEKEISSYKN
Ga0208331_122571	Ga0208331_1225711	F084703	EVLPSSHLRGMFSTAVPRFLPDKLEPLGLSLSGQLRVAS
Ga0208331_127165	Ga0208331_1271651	F001487	MKKFTIEVSHASPAQLTTIGLELKIMSNGWEKFGLR