NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F085909

Metagenome Family F085909

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085909
Family Type Metagenome
Number of Sequences 111
Average Sequence Length 42 residues
Representative Sequence MAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQ
Number of Associated Samples 87
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.20 %
% of genes near scaffold ends (potentially truncated) 97.30 %
% of genes from short scaffolds (< 2000 bps) 88.29 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.685 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.225 % of family members)
Environment Ontology (ENVO) Unclassified
(26.126 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.649 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.66%    β-sheet: 0.00%    Coil/Unstructured: 56.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF08031BBE 3.60
PF00144Beta-lactamase 3.60
PF00478IMPDH 3.60
PF01784NIF3 2.70
PF02219MTHFR 1.80
PF12850Metallophos_2 1.80
PF00685Sulfotransfer_1 1.80
PF00005ABC_tran 1.80
PF08281Sigma70_r4_2 1.80
PF13302Acetyltransf_3 0.90
PF02774Semialdhyde_dhC 0.90
PF02371Transposase_20 0.90
PF13840ACT_7 0.90
PF00464SHMT 0.90
PF02955GSH-S_ATP 0.90
PF04551GcpE 0.90
PF12681Glyoxalase_2 0.90
PF13649Methyltransf_25 0.90
PF01872RibD_C 0.90
PF02574S-methyl_trans 0.90
PF03841SelA 0.90
PF00291PALP 0.90
PF12697Abhydrolase_6 0.90
PF07366SnoaL 0.90
PF07992Pyr_redox_2 0.90
PF12401FhaA_N 0.90
PF03060NMO 0.90
PF01243Putative_PNPOx 0.90
PF13602ADH_zinc_N_2 0.90
PF00440TetR_N 0.90
PF00903Glyoxalase 0.90
PF11578DUF3237 0.90
PF12680SnoaL_2 0.90
PF05222AlaDh_PNT_N 0.90
PF13376OmdA 0.90
PF13275S4_2 0.90
PF01106NifU 0.90
PF01418HTH_6 0.90
PF13561adh_short_C2 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG2367Beta-lactamase class ADefense mechanisms [V] 3.60
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 3.60
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 3.60
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 3.60
COG3323PII-like insert in the uncharacterized protein YqfO, YbgI/NIF3 familyFunction unknown [S] 2.70
COG0327Putative GTP cyclohydrolase 1 type 2, NIF3 familyCoenzyme transport and metabolism [H] 2.70
COG0189Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamilyTranslation, ribosomal structure and biogenesis [J] 1.80
COG06855,10-methylenetetrahydrofolate reductaseAmino acid transport and metabolism [E] 1.80
COG0694Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domainPosttranslational modification, protein turnover, chaperones [O] 0.90
COG3547TransposaseMobilome: prophages, transposons [X] 0.90
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.90
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.90
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.90
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG1737DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domainsTranscription [K] 0.90
COG08214-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpELipid transport and metabolism [I] 0.90
COG0002N-acetyl-gamma-glutamylphosphate reductaseAmino acid transport and metabolism [E] 0.90
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.90
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.90
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.90
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.90
COG0136Aspartate-semialdehyde dehydrogenaseAmino acid transport and metabolism [E] 0.90
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.68 %
UnclassifiedrootN/A15.32 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459015|G14TP7Y02IZ973Not Available500Open in IMG/M
3300000956|JGI10216J12902_100967629Not Available858Open in IMG/M
3300000956|JGI10216J12902_101955111All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300001213|JGIcombinedJ13530_108949823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria795Open in IMG/M
3300002568|C688J35102_119501843All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300004067|Ga0055485_10038904All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300004463|Ga0063356_100051799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4143Open in IMG/M
3300005338|Ga0068868_100575053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium996Open in IMG/M
3300005548|Ga0070665_100198011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2010Open in IMG/M
3300005564|Ga0070664_100988603All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300005764|Ga0066903_100189694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3051Open in IMG/M
3300005840|Ga0068870_11410169All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300006047|Ga0075024_100018551All Organisms → cellular organisms → Bacteria2804Open in IMG/M
3300006178|Ga0075367_10237246All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300006353|Ga0075370_10141889All Organisms → cellular organisms → Bacteria1404Open in IMG/M
3300006854|Ga0075425_101488905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300006894|Ga0079215_10944461All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300006904|Ga0075424_101280566Not Available780Open in IMG/M
3300006954|Ga0079219_10046106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus1845Open in IMG/M
3300009100|Ga0075418_10055581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4234Open in IMG/M
3300009101|Ga0105247_10640159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300009148|Ga0105243_10660713All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300009148|Ga0105243_10873188All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300009156|Ga0111538_13782141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300009176|Ga0105242_11228707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300009553|Ga0105249_10241520All Organisms → cellular organisms → Bacteria1786Open in IMG/M
3300009789|Ga0126307_10033088All Organisms → cellular organisms → Bacteria3988Open in IMG/M
3300010036|Ga0126305_10292110All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300010037|Ga0126304_10262005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1139Open in IMG/M
3300010037|Ga0126304_10884014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M
3300010039|Ga0126309_10878930All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300010045|Ga0126311_10738059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300010166|Ga0126306_10102522All Organisms → cellular organisms → Bacteria2071Open in IMG/M
3300010166|Ga0126306_10515334All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300012042|Ga0136627_1164151All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300012090|Ga0153956_1001411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria21076Open in IMG/M
3300012094|Ga0136638_10637112All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300012183|Ga0136624_1168230All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300012186|Ga0136620_10397209All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012188|Ga0136618_10010487All Organisms → cellular organisms → Bacteria4066Open in IMG/M
3300012188|Ga0136618_10090470All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300012208|Ga0137376_10284142All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300012354|Ga0137366_10267778Not Available1263Open in IMG/M
3300012355|Ga0137369_10696830All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300012684|Ga0136614_10384861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium1028Open in IMG/M
3300012955|Ga0164298_10357222Not Available928Open in IMG/M
3300012957|Ga0164303_11303637All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300012986|Ga0164304_10991366Not Available664Open in IMG/M
3300013096|Ga0157307_1082820All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300013296|Ga0157374_11396677Not Available723Open in IMG/M
3300014325|Ga0163163_12880900Not Available537Open in IMG/M
3300014325|Ga0163163_13310880All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300014326|Ga0157380_10473476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1209Open in IMG/M
3300014745|Ga0157377_10144912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1463Open in IMG/M
3300014745|Ga0157377_10887165Not Available665Open in IMG/M
3300014969|Ga0157376_10920984All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300014969|Ga0157376_11202790All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300015170|Ga0120098_1018339All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300015371|Ga0132258_10688497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2573Open in IMG/M
3300015371|Ga0132258_11651186Not Available1617Open in IMG/M
3300015374|Ga0132255_100473779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1836Open in IMG/M
3300015374|Ga0132255_105112113All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300017792|Ga0163161_10868872All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300018067|Ga0184611_1336477All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300018073|Ga0184624_10232797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria825Open in IMG/M
3300018083|Ga0184628_10169140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1140Open in IMG/M
3300018422|Ga0190265_10359103All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300018422|Ga0190265_11683764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300018429|Ga0190272_11105562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300018429|Ga0190272_11668016All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300018432|Ga0190275_10329974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1508Open in IMG/M
3300018432|Ga0190275_12059343All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300018469|Ga0190270_10154515Not Available1870Open in IMG/M
3300018469|Ga0190270_10470483Not Available1188Open in IMG/M
3300018469|Ga0190270_11202457All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300018469|Ga0190270_12834990All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300018476|Ga0190274_11314756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia810Open in IMG/M
3300018481|Ga0190271_10657758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1169Open in IMG/M
3300018481|Ga0190271_11258466All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300018481|Ga0190271_11731992All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300018481|Ga0190271_12476815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300018481|Ga0190271_12958100All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300018481|Ga0190271_13231155All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300019356|Ga0173481_10046507All Organisms → cellular organisms → Bacteria1474Open in IMG/M
3300019361|Ga0173482_10516878All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300019361|Ga0173482_10540053Not Available574Open in IMG/M
3300022932|Ga0247807_10249979All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300025908|Ga0207643_10135365All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300026067|Ga0207678_10811719All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300026075|Ga0207708_11017004Not Available720Open in IMG/M
3300026121|Ga0207683_10109649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae2471Open in IMG/M
3300027636|Ga0214469_1005855All Organisms → cellular organisms → Bacteria4492Open in IMG/M
3300027694|Ga0209170_1169227Not Available756Open in IMG/M
3300027909|Ga0209382_12153759All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300028589|Ga0247818_10753811All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300028589|Ga0247818_10784199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae664Open in IMG/M
3300028592|Ga0247822_10251607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1337Open in IMG/M
3300028592|Ga0247822_11743950All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300028790|Ga0307283_10206446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300028889|Ga0247827_10656502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces678Open in IMG/M
3300030336|Ga0247826_11225162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300030606|Ga0299906_10298490All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300031228|Ga0299914_10403679All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300031229|Ga0299913_10148046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2316Open in IMG/M
3300031671|Ga0307372_10365169All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300031731|Ga0307405_11143206Not Available671Open in IMG/M
3300031938|Ga0308175_102453955All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300031940|Ga0310901_10065342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → Agromyces ramosus1231Open in IMG/M
3300032012|Ga0310902_11092407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae558Open in IMG/M
3300033412|Ga0310810_11232864Not Available601Open in IMG/M
3300033475|Ga0310811_11173406All Organisms → cellular organisms → Bacteria637Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.11%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil7.21%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand6.31%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.50%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.60%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.70%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.80%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.80%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.90%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.90%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.90%
FossillEnvironmental → Terrestrial → Soil → Fossil → Unclassified → Fossill0.90%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.90%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.90%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.90%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.90%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.90%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459015Litter degradation PV4EngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004067Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300012042Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06)EnvironmentalOpen in IMG/M
3300012090Attine ant fungus gardens microbial communities from Florida, USA - TSFL040 MetaGHost-AssociatedOpen in IMG/M
3300012094Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06)EnvironmentalOpen in IMG/M
3300012183Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ469 (22.06)EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012188Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015170Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300022932Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L074-202C-1EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027636Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeqEnvironmentalOpen in IMG/M
3300027694Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk (SPAdes)EngineeredOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031671Soil microbial communities from Risofladan, Vaasa, Finland - OX-1EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4PV_031585702170459015Switchgrass, Maize And Mischanthus LitterVAIRQLELDALVQTGEQRRTVSGKDRLHYEPVLVDQSQVCQRQGDVSRPPT
JGI10216J12902_10096762913300000956SoilVNELEWDALPQTGEQRRTVTGEDRLNDELVLVDQPQIC
JGI10216J12902_10195511113300000956SoilMAIHQRELDALAQTGQQRRPMAGEDRLHDKRVLVDQSQICQRQGERH
JGIcombinedJ13530_10894982333300001213WetlandVAIHQLELDALAQTREQCRPVSGKDRLYEELVLVDQSQICQRQG
C688J35102_11950184313300002568SoilMAIHELELDAVAQTGEQRRSVSGKDWLHKELVLVDESQICQ
Ga0055485_1003890423300004067Natural And Restored WetlandsMASHELDLDALAQTGEQRRPVSGKDRLHEELVLVDQSQICQRQG
Ga0063356_10005179913300004463Arabidopsis Thaliana RhizosphereMAIHQLELDALAQTAEQRRPVSRKDRLHKELELVDQSQICQR
Ga0068868_10057505323300005338Miscanthus RhizosphereMAMHELELDPLLQTGEQRRPMARQNRLHEELVLVDQSQIRQ
Ga0070665_10019801143300005548Switchgrass RhizosphereMAIHELELDAFAQTGEQRRPVSGQDRLHKELVLVDQSQICQRQGERHATHE
Ga0070664_10098860323300005564Corn RhizosphereMAIHELELDALAQTGEQRRPVSGKDRLHKERVLVDQSQICQRQGERH
Ga0066903_10018969453300005764Tropical Forest SoilMALDQLELDALAQTGEQRRPVSGKNRLDKELVLVDQSQICQRQ
Ga0068870_1141016913300005840Miscanthus RhizosphereMAIHELELDALAQTSEQRRPVSGKDRLHKELVLVDQSQ
Ga0075024_10001855153300006047WatershedsMAIHQIELDPLAQTGEQRRPVSGQDRLHKELVLVDQSQI
Ga0075367_1023724613300006178Populus EndosphereMAIHQLELDALAQTREQRRPVSGKDRLHKELVLVDQSQIG
Ga0075370_1014188913300006353Populus EndosphereMAIHQLELDALAQTREQRRPVSGKDRLHKELVLVDQSQICQRQGERH
Ga0075425_10148890523300006854Populus RhizosphereMAIHELELDALAQTGEQRRPVPGKDRLHKELVLVDQSQICQRQGECHATHEQ
Ga0079215_1094446123300006894Agricultural SoilMHELELDPLVQTGEQRRPMARQNRLHEELVLVDQSQIR
Ga0075424_10128056623300006904Populus RhizosphereMHELEPDPVLQTGEQRRPMARQNRLHEELVLVDQSQIRQGQ
Ga0079219_1004610633300006954Agricultural SoilMAIHELKLDALMQTGEQRRSVSGKDRLHKELVLVD
Ga0075418_1005558113300009100Populus RhizosphereMAIHQLELDALAQTGEQRRPVSGKDRLHKELVLVDQ
Ga0105247_1064015913300009101Switchgrass RhizosphereMPIHQLELDALAQTREQRRPVSRKDRLHDERVLVDESQICQRQRER
Ga0105243_1066071313300009148Miscanthus RhizosphereMAIHELELDALAQTGEQRRPVSGKDRLHKERVLVDQSQICQRQGE
Ga0105243_1087318813300009148Miscanthus RhizosphereMAIRELELDALAQTGEQRRPVSGKDRLHKEHVLVDQSQ
Ga0111538_1378214123300009156Populus RhizosphereMAIHEFELDALAQTGEQRRPVSGEDRLHKELVLVDQS
Ga0105242_1122870733300009176Miscanthus RhizosphereMAIHELDLDALAQTCEQRRPVSGEDRLHEELVLVD
Ga0105249_1024152013300009553Switchgrass RhizosphereMAIHELELDALAQTGEQRRPVSGKDRLHKERVLVDQSQICQRQG
Ga0126307_1003308813300009789Serpentine SoilVAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQ
Ga0126305_1029211023300010036Serpentine SoilMAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQ
Ga0126304_1026200523300010037Serpentine SoilMAIHELELNALAQTGEQRRPVSGKDRLHKELVLVDQSQICQR
Ga0126304_1088401423300010037Serpentine SoilMAVHELELDAPAQTGEQRRPVSGEDRLHKEHVLVDQS
Ga0126309_1087893023300010039Serpentine SoilMAIHDLELDALAQTGEQRRPMSGKDRLHKEHVLVDQSEICQRQS*
Ga0126311_1073805913300010045Serpentine SoilMAMHELKLDPLLQTGEQRRPMARQNRLHEELVLVDQSQI
Ga0126306_1010252213300010166Serpentine SoilVAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERHA
Ga0126306_1051533413300010166Serpentine SoilMAIHELELDALAQTGEQRRPVSGKDRLHKEHVLVDQSQI
Ga0136627_116415123300012042Polar Desert SandMAIHQLELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERHAT
Ga0153956_100141133300012090Attine Ant Fungus GardensMAIHELHLDALAQTGEQRRPVSGKDRLHEELVCFSR*
Ga0136638_1063711213300012094Polar Desert SandMAIHKLKLDAFAQTGEQRRPVSGKDRLHKELVLVDQSQI
Ga0136624_116823023300012183Polar Desert SandMAIHQLELDALAQTGEQRRPVSGKDRLHKELVLVD
Ga0136620_1039720913300012186Polar Desert SandMAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDKSQICQ
Ga0136618_1001048713300012188Polar Desert SandMAIHELELDALAQTGEQRRPVSGKDRLHKEHVLVDQSQICQRQG
Ga0136618_1009047013300012188Polar Desert SandMAIHKLKLDAFAQTGEQRRPVSGKDRLHKELVLVDQSQ
Ga0137376_1028414233300012208Vadose Zone SoilMAIHELELDALAQPGEQRRPVSGKDRLHKELVLVDQSQICQ
Ga0137366_1026777823300012354Vadose Zone SoilMAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRAGERHATHE*
Ga0137369_1069683013300012355Vadose Zone SoilMAIHELELDALGQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERH
Ga0136614_1038486123300012684Polar Desert SandMAIHQLELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGE
Ga0164298_1035722213300012955SoilMAIDQLELDALSQTGKQRRPVSGKHRLHEKFVLVDQSQI
Ga0164303_1130363723300012957SoilMAIHELELDAFAQTGEQGRPVSGKDRLHKAQVLVDQSQL
Ga0164304_1099136623300012986SoilLAIHELQLDALAQTGEKGRPVSGKDRLHKERVFVDQTQICQRQGERHTTHEQ
Ga0157307_108282023300013096SoilMAIHELELDTFAQTGEQRRPVSGKDRLHKELVLVDQSQIC
Ga0157374_1139667723300013296Miscanthus RhizosphereMAIHERELDALAQTGEQRRPLSGKDRLHKELVLVDQSQICQRQG
Ga0163163_1288090023300014325Switchgrass RhizosphereMAIHELELDALAQTGEQRRPMSGKDRLHEELVLVDQSQICQRQ
Ga0163163_1331088023300014325Switchgrass RhizosphereMAIHELELDALAQTGEQRRSVSGKDRLHKEHVLVDQSQICQRQGERHATHE
Ga0157380_1047347613300014326Switchgrass RhizosphereMAIHELDLDALAQAGEQRRPVSGKDRLHKELVLVDQSQICQ
Ga0157377_1014491243300014745Miscanthus RhizosphereMAIHELDLDALAQTGEQRRPVSGKDRLHKERVLVDQSQICQRQGERHATHEE
Ga0157377_1088716523300014745Miscanthus RhizosphereVAIRQLELDALVQTGEQRRTASGKDRLHYEPVLVDQSQVCQRQGECHSTHE
Ga0157376_1092098413300014969Miscanthus RhizosphereMAIHELDLDALAQTGEQRRPVSDKDRLHDELVLVDQSQFCQRQGE
Ga0157376_1120279023300014969Miscanthus RhizosphereMPLHELELDALAQTGEQRRPVPGKDRLHNELVLVDQSQICQ
Ga0120098_101833933300015170FossillMAIHELDLDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERHAT
Ga0132258_1068849753300015371Arabidopsis RhizosphereMAIHELELDALAQTGEQGRPVSGKDRLHKELVLVDQSQICQRQGERH
Ga0132258_1165118613300015371Arabidopsis RhizosphereMAIHKLELDALAQTGEQRRPVSGKDRLHNELVLVDQSQICQRQ
Ga0132255_10047377913300015374Arabidopsis RhizosphereMPIHQLELNALAQTREQRRPVSRKDRLHDERVLVDES
Ga0132255_10511211313300015374Arabidopsis RhizosphereMAVHELELDALAQTSEQRRPVPGNDRLHKKLVLVDQSQI
Ga0163161_1086887233300017792Switchgrass RhizosphereMAIHELELDAFAQTGEQGRPVSGKDRLHKEHVLVDQSQ
Ga0184611_133647713300018067Groundwater SedimentMAINQLEPDALPQTGEQRRPVSGKDWLHKELVFVDQSQICQRQGE
Ga0184624_1023279723300018073Groundwater SedimentMHELELDPLAQTGEQRRPMARQNRLHEELVLVDQSQIRQGQ
Ga0184628_1016914033300018083Groundwater SedimentMHELELDPLLQTGEQRRPMARQNRLHEELVLVDQPQIRQGQRE
Ga0190265_1035910343300018422SoilMAIHELELDAFAQTGEQRRPVSGKDRLHKELVLVDQPQICQRQ
Ga0190265_1168376413300018422SoilMAIHELELYALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQ
Ga0190272_1110556223300018429SoilMAIHELELDALAQTGEQRRPVSGKDRLHKEHVLVDQSQICQRQGERHA
Ga0190272_1166801613300018429SoilMAIHELDLDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERHA
Ga0190275_1032997413300018432SoilMAIDELELDSLTQTGEQRRPVSGNDRLDDELVLVDQSQIC
Ga0190275_1205934323300018432SoilMAIHQLELDTFAQTGEQGRPVSGKDRLHKEHVLVNQSQ
Ga0190270_1015451533300018469SoilMAVHELELDAFAQTGEQRRPVSGEDRLHEELVLVDQSQ
Ga0190270_1047048343300018469SoilMAIHELELDGRAQPGEQRRPVSGKDRLHKELVLVDQSQICQ
Ga0190270_1120245713300018469SoilMAIHELKLNALAQTGEQRRPVSGKDRLHKELVLVDESQI
Ga0190270_1283499023300018469SoilMAIHEFELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGER
Ga0190274_1131475613300018476SoilMAIHELKLNALAQTGEQRRPVSGKDRLHEELVLVDQSQI
Ga0190271_1065775813300018481SoilMAIHELKLNALAQTGEQRRPVSGKDRLHKELVLVDE
Ga0190271_1125846623300018481SoilMAIHELELAALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGE
Ga0190271_1173199213300018481SoilMAIHALELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQG
Ga0190271_1247681513300018481SoilMAVHELELDALAQTGEQRRPVSGKDRLHKELVLVDQ
Ga0190271_1295810023300018481SoilMAIHELKLNALTQTGEQRRPVSGKDRLHKELVLVDQSQICQ
Ga0190271_1323115523300018481SoilMAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQ
Ga0173481_1004650733300019356SoilMAVHKLELDALAQTGEQRRPVSGKDRLHEEDVLVDQSQICQRQ
Ga0173482_1051687813300019361SoilMAIHELELDTFAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQGERH
Ga0173482_1054005313300019361SoilMAIHQLQLDALAQAGEQRRSVARKDRLNKELVLVDQSQICQRQGK
Ga0247807_1024997913300022932Plant LitterMAVDEVELNALAQASKQSRAVSGKDRLYKEFVLVDQSQICQSQ
Ga0207643_1013536513300025908Miscanthus RhizosphereMAIDQLELDALSQTGKQRRPVSGKHRLHEEFVLVDQSQIRQRQGE
Ga0207678_1081171913300026067Corn RhizosphereMAIHELDLDALAQTGEQRRPVSGKDRLHKELVLVDESQICQRQGER
Ga0207708_1101700423300026075Corn, Switchgrass And Miscanthus RhizosphereMAIHELDLDALAQTGEERRPVSGKDRLHNEHVLVDQSQICQRQGQRHAT
Ga0207683_1010964933300026121Miscanthus RhizosphereMAIDQLELDSLSQTGKQRRPVSGKHRLHEKFVLVDQSQICQRQG
Ga0214469_100585573300027636SoilMAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQS
Ga0209170_116922733300027694Activated SludgeMALHELELYALAQTGEQRRPASGKDRLHEELVLVDQSQIRQRQGKR
Ga0209382_1215375913300027909Populus RhizosphereMAIHKLELDALAKTGEQRRPVSGQDRLHKELVLVDQSQI
Ga0247818_1075381123300028589SoilMAIHELELDALAQTGEQRRPVSGQDWLHKERVLVDQSQICQRQG
Ga0247818_1078419913300028589SoilMAIDELKLNALAQTGEQRRPVSGKDRLHKELVLVDKSQIGQRQG
Ga0247822_1025160713300028592SoilMAIHELEMDALAQTGEQRGPVSGKDRLHEEHVLVDQSQIC
Ga0247822_1174395013300028592SoilMHELELDPLLQTGEQRRPMARQNRLHEELVLVDQP
Ga0307283_1020644613300028790SoilMTIHELELDALAQTGKQRRAMSGKDRLHKKLVLVNQPQICQRQGESH
Ga0247827_1065650213300028889SoilMAIHELELNALTQAGEQRRSVSGEDRLHDELVLVDQSQ
Ga0247826_1122516213300030336SoilMAIDQLELDALSQTGKQRRPVSGKHRLHEEFVLVDQS
Ga0299906_1029849013300030606SoilMAIHELELDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQ
Ga0299914_1040367923300031228SoilMAVHQLDLDALAQTGEQRRPVSGKDRLHKELVLVD
Ga0299913_1014804643300031229SoilMAIHELELDALAQTGEQRRPVSGEDRLHNELVLVDQSQICQ
Ga0307372_1036516923300031671SoilMATHELELDALAQTGEQRRPMSGKDRLHNELVLVDQSQICQRQG
Ga0307405_1114320613300031731RhizosphereMAIHELELDASAKTGEQRRPVSGKDRLHKELILVDQSQICQRQGERHATQE
Ga0308175_10245395513300031938SoilMAIHELEPDALAQTGQQRRPVPGKDGLHKEHVIVDQSQ
Ga0310901_1006534213300031940SoilMAIHQLELDALAQTGKQRRPVSGKHRLHKELVLVDQSQICQRQRE
Ga0310902_1109240713300032012SoilMAIDELKLNALAQTGEQRRPVSGKDRLHKELVLVD
Ga0310810_1123286413300033412SoilMHELELDPLLQTGEQRRPMARQNRLHEELVLVDQSQIRQRQGERHATHQQT
Ga0310811_1117340623300033475SoilMAIHELDLDALAQTGEQRRPVSGKDRLHKELVLVDQSQICQRQRERHAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.