| Basic Information | |
|---|---|
| Family ID | F068385 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MISLVSYEMKETPQFKTIMRAKDSISKIKDLSSLKCHKEMKDTFS |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 41.13 % |
| % of genes near scaffold ends (potentially truncated) | 86.29 % |
| % of genes from short scaffolds (< 2000 bps) | 95.97 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (87.097 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (79.032 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.129 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (70.968 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.16% β-sheet: 0.00% Coil/Unstructured: 43.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00931 | NB-ARC | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 87.10 % |
| All Organisms | root | All Organisms | 12.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005335|Ga0070666_10469113 | Not Available | 910 | Open in IMG/M |
| 3300005347|Ga0070668_101870761 | Not Available | 552 | Open in IMG/M |
| 3300005440|Ga0070705_101806305 | Not Available | 518 | Open in IMG/M |
| 3300005615|Ga0070702_101401055 | Not Available | 571 | Open in IMG/M |
| 3300005617|Ga0068859_102127038 | Not Available | 619 | Open in IMG/M |
| 3300005841|Ga0068863_102419962 | Not Available | 535 | Open in IMG/M |
| 3300009092|Ga0105250_10388690 | Not Available | 617 | Open in IMG/M |
| 3300009975|Ga0105129_108662 | Not Available | 658 | Open in IMG/M |
| 3300009981|Ga0105133_113813 | Not Available | 650 | Open in IMG/M |
| 3300009989|Ga0105131_132603 | Not Available | 561 | Open in IMG/M |
| 3300009989|Ga0105131_139094 | Not Available | 526 | Open in IMG/M |
| 3300009990|Ga0105132_113945 | Not Available | 722 | Open in IMG/M |
| 3300009992|Ga0105120_1051041 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 524 | Open in IMG/M |
| 3300009995|Ga0105139_1054076 | Not Available | 713 | Open in IMG/M |
| 3300010274|Ga0134100_1064682 | Not Available | 666 | Open in IMG/M |
| 3300010371|Ga0134125_12419934 | Not Available | 571 | Open in IMG/M |
| 3300010396|Ga0134126_12060803 | Not Available | 623 | Open in IMG/M |
| 3300010399|Ga0134127_11672080 | Not Available | 711 | Open in IMG/M |
| 3300015270|Ga0182183_1008510 | Not Available | 1009 | Open in IMG/M |
| 3300015270|Ga0182183_1064324 | Not Available | 572 | Open in IMG/M |
| 3300015273|Ga0182102_1040165 | Not Available | 526 | Open in IMG/M |
| 3300015278|Ga0182099_1037990 | Not Available | 608 | Open in IMG/M |
| 3300015280|Ga0182100_1024707 | Not Available | 795 | Open in IMG/M |
| 3300015280|Ga0182100_1029614 | Not Available | 753 | Open in IMG/M |
| 3300015284|Ga0182101_1078004 | Not Available | 550 | Open in IMG/M |
| 3300015290|Ga0182105_1010463 | Not Available | 1050 | Open in IMG/M |
| 3300015290|Ga0182105_1049634 | Not Available | 660 | Open in IMG/M |
| 3300015290|Ga0182105_1055058 | Not Available | 638 | Open in IMG/M |
| 3300015290|Ga0182105_1066811 | Not Available | 598 | Open in IMG/M |
| 3300015297|Ga0182104_1051225 | Not Available | 680 | Open in IMG/M |
| 3300015301|Ga0182184_1024708 | Not Available | 803 | Open in IMG/M |
| 3300015301|Ga0182184_1028194 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 771 | Open in IMG/M |
| 3300015309|Ga0182098_1110285 | Not Available | 531 | Open in IMG/M |
| 3300015310|Ga0182162_1049897 | Not Available | 711 | Open in IMG/M |
| 3300015312|Ga0182168_1053502 | Not Available | 716 | Open in IMG/M |
| 3300015316|Ga0182121_1112687 | Not Available | 560 | Open in IMG/M |
| 3300015317|Ga0182136_1011853 | Not Available | 1158 | Open in IMG/M |
| 3300015319|Ga0182130_1069186 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 647 | Open in IMG/M |
| 3300015319|Ga0182130_1071502 | Not Available | 640 | Open in IMG/M |
| 3300015320|Ga0182165_1050168 | Not Available | 757 | Open in IMG/M |
| 3300015320|Ga0182165_1090012 | Not Available | 612 | Open in IMG/M |
| 3300015320|Ga0182165_1146499 | Not Available | 503 | Open in IMG/M |
| 3300015325|Ga0182148_1054320 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 724 | Open in IMG/M |
| 3300015325|Ga0182148_1066278 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 676 | Open in IMG/M |
| 3300015325|Ga0182148_1084492 | Not Available | 620 | Open in IMG/M |
| 3300015326|Ga0182166_1088374 | Not Available | 608 | Open in IMG/M |
| 3300015330|Ga0182152_1006274 | Not Available | 1461 | Open in IMG/M |
| 3300015330|Ga0182152_1127318 | Not Available | 545 | Open in IMG/M |
| 3300015331|Ga0182131_1088436 | Not Available | 631 | Open in IMG/M |
| 3300015332|Ga0182117_1074095 | Not Available | 711 | Open in IMG/M |
| 3300015332|Ga0182117_1117739 | Not Available | 589 | Open in IMG/M |
| 3300015333|Ga0182147_1071562 | Not Available | 712 | Open in IMG/M |
| 3300015333|Ga0182147_1108002 | Not Available | 607 | Open in IMG/M |
| 3300015335|Ga0182116_1018205 | Not Available | 1180 | Open in IMG/M |
| 3300015335|Ga0182116_1027906 | Not Available | 1031 | Open in IMG/M |
| 3300015335|Ga0182116_1156724 | Not Available | 535 | Open in IMG/M |
| 3300015338|Ga0182137_1035210 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 952 | Open in IMG/M |
| 3300015339|Ga0182149_1074077 | Not Available | 711 | Open in IMG/M |
| 3300015340|Ga0182133_1028551 | Not Available | 1046 | Open in IMG/M |
| 3300015340|Ga0182133_1067845 | Not Available | 773 | Open in IMG/M |
| 3300015340|Ga0182133_1109058 | Not Available | 642 | Open in IMG/M |
| 3300015340|Ga0182133_1188328 | Not Available | 506 | Open in IMG/M |
| 3300015340|Ga0182133_1188638 | Not Available | 506 | Open in IMG/M |
| 3300015348|Ga0182115_1291814 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 515 | Open in IMG/M |
| 3300015349|Ga0182185_1001703 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 2978 | Open in IMG/M |
| 3300015349|Ga0182185_1016273 | Not Available | 1609 | Open in IMG/M |
| 3300015349|Ga0182185_1285935 | Not Available | 504 | Open in IMG/M |
| 3300015350|Ga0182163_1035013 | Not Available | 1345 | Open in IMG/M |
| 3300015350|Ga0182163_1035528 | Not Available | 1338 | Open in IMG/M |
| 3300015350|Ga0182163_1077318 | Not Available | 984 | Open in IMG/M |
| 3300015350|Ga0182163_1132459 | Not Available | 770 | Open in IMG/M |
| 3300015350|Ga0182163_1210940 | Not Available | 609 | Open in IMG/M |
| 3300015353|Ga0182179_1137640 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 755 | Open in IMG/M |
| 3300015353|Ga0182179_1272073 | Not Available | 548 | Open in IMG/M |
| 3300015354|Ga0182167_1250528 | Not Available | 638 | Open in IMG/M |
| 3300015354|Ga0182167_1281183 | Not Available | 594 | Open in IMG/M |
| 3300015354|Ga0182167_1288467 | Not Available | 585 | Open in IMG/M |
| 3300017408|Ga0182197_1070591 | Not Available | 672 | Open in IMG/M |
| 3300017408|Ga0182197_1106042 | Not Available | 577 | Open in IMG/M |
| 3300017412|Ga0182199_1058196 | Not Available | 809 | Open in IMG/M |
| 3300017414|Ga0182195_1016657 | Not Available | 1259 | Open in IMG/M |
| 3300017414|Ga0182195_1051168 | Not Available | 879 | Open in IMG/M |
| 3300017421|Ga0182213_1252671 | Not Available | 505 | Open in IMG/M |
| 3300017432|Ga0182196_1067944 | Not Available | 671 | Open in IMG/M |
| 3300017445|Ga0182198_1149342 | Not Available | 568 | Open in IMG/M |
| 3300017691|Ga0182212_1092306 | Not Available | 677 | Open in IMG/M |
| 3300017693|Ga0182216_1003538 | Not Available | 2246 | Open in IMG/M |
| 3300017693|Ga0182216_1095121 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 707 | Open in IMG/M |
| 3300017693|Ga0182216_1184922 | Not Available | 544 | Open in IMG/M |
| 3300017694|Ga0182211_1116781 | Not Available | 628 | Open in IMG/M |
| 3300017694|Ga0182211_1153169 | Not Available | 549 | Open in IMG/M |
| 3300022466|Ga0213504_101381 | Not Available | 945 | Open in IMG/M |
| 3300026088|Ga0207641_12211498 | Not Available | 550 | Open in IMG/M |
| 3300028049|Ga0268322_1052191 | Not Available | 518 | Open in IMG/M |
| 3300028054|Ga0268306_1017047 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 636 | Open in IMG/M |
| 3300028056|Ga0268330_1001776 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
| 3300028144|Ga0268345_1017228 | Not Available | 594 | Open in IMG/M |
| 3300028475|Ga0268327_1008366 | Not Available | 714 | Open in IMG/M |
| 3300028475|Ga0268327_1019038 | Not Available | 563 | Open in IMG/M |
| 3300028475|Ga0268327_1023898 | Not Available | 526 | Open in IMG/M |
| 3300032464|Ga0214492_1000214 | Not Available | 4581 | Open in IMG/M |
| 3300032465|Ga0214493_1028673 | Not Available | 1252 | Open in IMG/M |
| 3300032466|Ga0214503_1043281 | Not Available | 1328 | Open in IMG/M |
| 3300032467|Ga0214488_1061971 | Not Available | 829 | Open in IMG/M |
| 3300032468|Ga0214482_1047630 | Not Available | 829 | Open in IMG/M |
| 3300032502|Ga0214490_1023799 | Not Available | 1296 | Open in IMG/M |
| 3300032502|Ga0214490_1115076 | Not Available | 612 | Open in IMG/M |
| 3300032625|Ga0214501_1236766 | Not Available | 579 | Open in IMG/M |
| 3300032697|Ga0214499_1240929 | Not Available | 558 | Open in IMG/M |
| 3300032760|Ga0314754_1002425 | Not Available | 2237 | Open in IMG/M |
| 3300032792|Ga0314744_1000489 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 3986 | Open in IMG/M |
| 3300032812|Ga0314745_1018507 | Not Available | 1397 | Open in IMG/M |
| 3300032825|Ga0314724_105998 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1202 | Open in IMG/M |
| 3300032843|Ga0314736_1049526 | Not Available | 538 | Open in IMG/M |
| 3300032844|Ga0314743_1053337 | Not Available | 945 | Open in IMG/M |
| 3300032844|Ga0314743_1150744 | Not Available | 511 | Open in IMG/M |
| 3300032889|Ga0314751_1097820 | Not Available | 591 | Open in IMG/M |
| 3300032890|Ga0314747_1064565 | Not Available | 526 | Open in IMG/M |
| 3300032913|Ga0314739_1097394 | Not Available | 538 | Open in IMG/M |
| 3300032915|Ga0314749_1094765 | Not Available | 642 | Open in IMG/M |
| 3300032934|Ga0314741_1037211 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1105 | Open in IMG/M |
| 3300032976|Ga0314752_1036605 | Not Available | 934 | Open in IMG/M |
| 3300033526|Ga0314761_1032971 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1114 | Open in IMG/M |
| 3300033533|Ga0314770_1216762 | Not Available | 600 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 79.03% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 5.65% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 5.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010274 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 11_42_5_180_A3 metaG | Engineered | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300022466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12SEP2016_LR1 MT pilot (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032468 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032760 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032825 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032843 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032889 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032890 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032913 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032976 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033533 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070666_104691131 | 3300005335 | Switchgrass Rhizosphere | MIRLVSYEM*NETPQFETIMHAKDSISKIKDISSLKCHKEMKDT*FS* |
| Ga0070668_1018707612 | 3300005347 | Switchgrass Rhizosphere | TGLVSYEI*KETPQFETIMRTKDSI*KIKDLSSLKCHKEMKDT*FS* |
| Ga0070705_1018063052 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MISLVSYEM*KETPQFKTIMRAKDSISKIKDLSSLKCHKEMKDT*FS* |
| Ga0070702_1014010551 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDLVPYEM*KETPQFVTITRAKDSISKIKDLSSLKCHKEMKDT*FR* |
| Ga0068859_1021270381 | 3300005617 | Switchgrass Rhizosphere | MINLVSYEMRKETPQFGTTMRAKDSISKIKELSSLKCHKEMKDT* |
| Ga0068863_1024199622 | 3300005841 | Switchgrass Rhizosphere | MIGLVSYEM*KETPQFETIMRAKDSI*KIKDLSSLKCH |
| Ga0105250_103886901 | 3300009092 | Switchgrass Rhizosphere | YEI*NETPQFETIMRAKDSISKIKDFSSLMCHKEMKDT*FS* |
| Ga0105129_1086621 | 3300009975 | Switchgrass Associated | PQFGTTMRAKDSILKIKNLSSLKCHKEMKDT*FS* |
| Ga0105133_1138131 | 3300009981 | Switchgrass Associated | I*NETPQFETIMRAKDSISKIKDLSSLMYHKEMKDT*FS* |
| Ga0105131_1326031 | 3300009989 | Switchgrass Associated | LVSYEI*KETPQFKTIMRANDSIPKINDLSSLKCHKEMNDT*FS* |
| Ga0105131_1390942 | 3300009989 | Switchgrass Associated | *KETFQFETIMRAKNSISKIKDFSSLKCHKEMKDT*FS* |
| Ga0105132_1139451 | 3300009990 | Switchgrass Associated | LMISLVSYEM*KETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDT*FS* |
| Ga0105120_10510412 | 3300009992 | Switchgrass Associated | MIDLVPYEM*KETPQFGTIMRAKDSISKIKDLSSLKCHK |
| Ga0105139_10540761 | 3300009995 | Switchgrass Associated | EI*NETPQFETIMRAKDSITKIKDISSLKCHKEMKDT*FS* |
| Ga0134100_10646821 | 3300010274 | Switchgrass Degrading | I*KETPQFETIMRTKDSI*KIKDLSSLKCHKEMKDTLFS* |
| Ga0134125_124199341 | 3300010371 | Terrestrial Soil | M*KETSQFKTIKRAKDSLSKIKDLSSVKCHKEMKDT*FS |
| Ga0134126_120608031 | 3300010396 | Terrestrial Soil | YEI*KETPQFETIMRVKDSISKIKDLSSLKCHKEMKDTSFS* |
| Ga0134127_116720801 | 3300010399 | Terrestrial Soil | MIRLVSYEI*NETPQFETIMRAKDSISKVKDISSLMCHKEMKDT*FS* |
| Ga0182183_10085102 | 3300015270 | Switchgrass Phyllosphere | EKLMIDLVPYEM*KETPQFGTIMRANDSISKIKDLSSLKCHKEMKDT*FS* |
| Ga0182183_10643241 | 3300015270 | Switchgrass Phyllosphere | GI*KETPQFETNMGVKDTFSKIKDSSSLKCHKEMKDT*FS* |
| Ga0182102_10401651 | 3300015273 | Switchgrass Phyllosphere | LMINLVSYEM*KETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDT*FS* |
| Ga0182099_10379901 | 3300015278 | Switchgrass Phyllosphere | SYEI*KETPQFKTIMRAKDSIPKIKDLSSLKCHKEMKGT*FS* |
| Ga0182100_10247072 | 3300015280 | Switchgrass Phyllosphere | MIVLVTYEI*KETPQFETIMRDKDSFSKIKDLSSLKCHKEMKDT*FSSGFIVFSS |
| Ga0182100_10296141 | 3300015280 | Switchgrass Phyllosphere | ETPQFGTTMRAKDSISKIKDLSSLKCHKEMKDT*FS* |
| Ga0182101_10780041 | 3300015284 | Switchgrass Phyllosphere | MIGLVSYEM*KETPKFETIMHAKDSISKIKDLSSLKCHKEMNDT*FS* |
| Ga0182105_10104633 | 3300015290 | Switchgrass Phyllosphere | MIGLVSYEM*KETPKFETIMRAKDSISKIKDLSSLKCHKEMNDT*FS* |
| Ga0182105_10496342 | 3300015290 | Switchgrass Phyllosphere | MFGLVTYEI*KETPQVETIMRAKNSFLKIKDHSSLKCHKEM |
| Ga0182105_10550581 | 3300015290 | Switchgrass Phyllosphere | EKSMIGLVSYKI*KETPQFEPIMRAMHSISKIKDISSLKCHKEMKDT* |
| Ga0182105_10668111 | 3300015290 | Switchgrass Phyllosphere | ENSMTGLVSYEI*KETPQFETIMRTKDSI*KIKDLSSLKCHKEMKDT*FS* |
| Ga0182104_10512251 | 3300015297 | Switchgrass Phyllosphere | MIVLVTYEI*KETPQFETIMCDKDSFSKIKDLSSLKCHKEMNDT*FSSGFIVFS |
| Ga0182184_10247081 | 3300015301 | Switchgrass Phyllosphere | KLMIKLVSYEM*KETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDT*FS* |
| Ga0182184_10281942 | 3300015301 | Switchgrass Phyllosphere | MIILVSYEMRKETPQFGTIMRAKDSILKIKDLSSLKCHKEM |
| Ga0182098_11102852 | 3300015309 | Switchgrass Phyllosphere | MIRIVSYEI*KETPQFKTIMHANDSIPKIKDLSSLKCHKEMKD |
| Ga0182162_10498971 | 3300015310 | Switchgrass Phyllosphere | VSYEI*KETPQFKTIMRAKDSIPNIKNFSSLKCHKEMKDT*FS* |
| Ga0182168_10535021 | 3300015312 | Switchgrass Phyllosphere | MIKLVSYEM*KETPQFGKTMRAKDSILKIKDLSSLKCHKEMKDT*IRLSFIDLS* |
| Ga0182121_11126871 | 3300015316 | Switchgrass Phyllosphere | EKSMIGLVSYEM*KETPQFETIMRAKDSISKIKDLSSLKYHKEMKDT*FS* |
| Ga0182136_10118532 | 3300015317 | Switchgrass Phyllosphere | EIWKETPQFETNMRVKDTFSKIKDSSSLKCHGEMKDT* |
| Ga0182130_10691861 | 3300015319 | Switchgrass Phyllosphere | MINLVSYEM*KETPQFGTIMRAKDSISKIKDLSSLKYHK |
| Ga0182130_10715021 | 3300015319 | Switchgrass Phyllosphere | ETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDT*FS* |
| Ga0182165_10501682 | 3300015320 | Switchgrass Phyllosphere | HMKCERRPPQFGTTMRAKDSILKIKDLSSLKCHKEMKDT* |
| Ga0182165_10900121 | 3300015320 | Switchgrass Phyllosphere | IIRLVSYEI*NETPQFETILRAKGSILKIKDLSSLKCHKDEGHLI* |
| Ga0182165_11464991 | 3300015320 | Switchgrass Phyllosphere | MIGLVSYKI*KETPQFEPIMRAMHSISKIKDISSLKCHKE |
| Ga0182148_10543201 | 3300015325 | Switchgrass Phyllosphere | MINLVSYEM*KETPQFGTIMRAKDSISKIKDLSSLKC |
| Ga0182148_10662781 | 3300015325 | Switchgrass Phyllosphere | MIGLVSYEM*KETPQFETIMRAKDSISKIKDLSSL |
| Ga0182148_10844921 | 3300015325 | Switchgrass Phyllosphere | TPQFKTIMRAKDSIPNIKDISSLKCHKEMKDT*FS* |
| Ga0182166_10883742 | 3300015326 | Switchgrass Phyllosphere | *NETPQFETIMRAKNSISKIKNLSSLMYHKEMKDT*FSYVL* |
| Ga0182152_10062741 | 3300015330 | Switchgrass Phyllosphere | MIRLVSYEM*KETPQFETIMRAKDSISHIKDLSSLKCHKEMNDT*F |
| Ga0182152_11273181 | 3300015330 | Switchgrass Phyllosphere | M*KETSQFKTIMHAKDSLSKIKDLSSVKCHKEMKGT*F |
| Ga0182131_10884362 | 3300015331 | Switchgrass Phyllosphere | MIGLVSYEM*KETPQFETIMRANELISKIKDLSSL |
| Ga0182117_10740952 | 3300015332 | Switchgrass Phyllosphere | MFGLVTYEI*KETPQFETIMRAKDSFLKIKDLSSLKCHKE |
| Ga0182117_11177391 | 3300015332 | Switchgrass Phyllosphere | MNGLVSYEM*KETPQFGTTMHAKDSILKIKDLSSLKC |
| Ga0182147_10715622 | 3300015333 | Switchgrass Phyllosphere | LVSYEM*KETPQFGTTMRAKDSISKIKDLSSLKCHKEMKDT*FS* |
| Ga0182147_11080021 | 3300015333 | Switchgrass Phyllosphere | MIRLVSYEI*NETPQFETIMRAKNSISKIKDLSSLMYHKETKDT*F |
| Ga0182116_10182051 | 3300015335 | Switchgrass Phyllosphere | IIIGLVTYEI*KETPQFETNMRAQNSFSKIKDLSSL* |
| Ga0182116_10279061 | 3300015335 | Switchgrass Phyllosphere | YEM*KETSQFKTIMRAKDSLSKIKDLSSVKCHKEMKDT*FS*SL* |
| Ga0182116_11567242 | 3300015335 | Switchgrass Phyllosphere | LVSYEM*KETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDT*FS* |
| Ga0182137_10352102 | 3300015338 | Switchgrass Phyllosphere | MINLVSYEMRKETSQFVTTMRAKDSILKVKDLSSLKCHK |
| Ga0182149_10740771 | 3300015339 | Switchgrass Phyllosphere | VKIDPLIRNNMHAKDSISKIKDLSSLKCHKEMKDT* |
| Ga0182133_10285511 | 3300015340 | Switchgrass Phyllosphere | MIRLVSYEM*KETPQFGTTMCAKDSILKIKDLSSLK |
| Ga0182133_10678451 | 3300015340 | Switchgrass Phyllosphere | MFGLVTYEI*KETTQFETIMRAKDSFLKIKDISSLKCHKEMKDT*FS |
| Ga0182133_11090581 | 3300015340 | Switchgrass Phyllosphere | EI*KETPQFETIMRTKDSI*KIKDLSSLKCHKEMKDT*CS* |
| Ga0182133_11883281 | 3300015340 | Switchgrass Phyllosphere | EI*KETPQFKTIMRAKDSILKIKDLSSLNCHKEMNDT*FS* |
| Ga0182133_11886381 | 3300015340 | Switchgrass Phyllosphere | M*KETPQFKRANDSF*KIKDPSSVKCHKEMNDT*FS* |
| Ga0182115_12918141 | 3300015348 | Switchgrass Phyllosphere | MVSLVSYEMSKETPPFGTNMRAKNSILKVKDFSSLKCHKEMKDT* |
| Ga0182185_10017034 | 3300015349 | Switchgrass Phyllosphere | MISLVSFEM*KETPQFETIMRANDSISKIKDISSLKCHKEMKDT*ARIYSF* |
| Ga0182185_10162732 | 3300015349 | Switchgrass Phyllosphere | MFGLVTYEI*KETPQFETIMRTKDSFLKIKDLSNFKCHKE |
| Ga0182185_12859351 | 3300015349 | Switchgrass Phyllosphere | MINLVSYEM*KETPQFGTIMRAKDSISKIKDLSSLKCHKKM |
| Ga0182163_10350131 | 3300015350 | Switchgrass Phyllosphere | MISLVSYEM*KETPQFGTTMRAKDSILKIKDLSSLKCHKEM |
| Ga0182163_10355281 | 3300015350 | Switchgrass Phyllosphere | MIKLVSYEM*KETPQFGTTMRAKDSISKIKDLSSLKCHKEM |
| Ga0182163_10773181 | 3300015350 | Switchgrass Phyllosphere | VTYEM*KETPQFSMNRRATYLILKIKDLSSIECHNEMKDA*FSSGFSSF* |
| Ga0182163_11324591 | 3300015350 | Switchgrass Phyllosphere | KKSMIGLVAYEI*KETPQFETIMRAKNSFSKVKDLSSLKCHKEMKDT*FS* |
| Ga0182163_12109401 | 3300015350 | Switchgrass Phyllosphere | MFGLVTYEI*KETTQFETIMRAKDSFLKIKDISSLKCHKEMKDT*FS* |
| Ga0182179_11376401 | 3300015353 | Switchgrass Phyllosphere | MINLVSYEM*KETPQFGTIMRAKDSISKIKDLSSLKYHKKMKDT*F |
| Ga0182179_12720731 | 3300015353 | Switchgrass Phyllosphere | MIGLVPYEM*KETPQFVTITRAKDSISKIKDLSSLKCHKEMKD |
| Ga0182167_12505281 | 3300015354 | Switchgrass Phyllosphere | MIRLVSYEI*NETPQFETIMRGKDSVSKIKDLSSLMCHK |
| Ga0182167_12811831 | 3300015354 | Switchgrass Phyllosphere | MFGLVTYEI*KETPQFETIMRAKDSFLKIKDLSSLKYHKEMKDTWFS* |
| Ga0182167_12884671 | 3300015354 | Switchgrass Phyllosphere | MISLVSYEM*KETPQFGTTMRAKDSILKIKDLSSLKCHKE |
| Ga0182197_10705911 | 3300017408 | Switchgrass Phyllosphere | IXKETPQFKTIMRAKDSIPKITDLSSLKCHKEMKDTXFS |
| Ga0182197_11060421 | 3300017408 | Switchgrass Phyllosphere | MKCEKRPIKFVTITRAKDSISKIKDLSSLKCHKEMKD |
| Ga0182199_10581961 | 3300017412 | Switchgrass Phyllosphere | MIGLVTYEIXKETPQFETIMRAKDSFLKIKDLSSLKYHKEMKDTXFS |
| Ga0182195_10166571 | 3300017414 | Switchgrass Phyllosphere | MVSLVSYEMSKETPQFGTNMRAKNSILKVKDLSSLKCH |
| Ga0182195_10511681 | 3300017414 | Switchgrass Phyllosphere | MIGLVPYEMXKETPQFVTITRAKDSISKIKDLSSLKCHKEMKD |
| Ga0182213_12526711 | 3300017421 | Switchgrass Phyllosphere | MNGLVSYEMXKETPQFGTTMRAKDSISKIKDLSSLK |
| Ga0182196_10679442 | 3300017432 | Switchgrass Phyllosphere | MINLVSYEMRIETPQFGTIMRAKDSISKIKDLSSLKCH |
| Ga0182198_11493421 | 3300017445 | Switchgrass Phyllosphere | HEIXKENPQFETIMRAKDSFSKIKDISSLKCHKEMKDTXFS |
| Ga0182212_10923061 | 3300017691 | Switchgrass Phyllosphere | EMXKETPQFGITMRAKDSILNIKELSSLKCHKEMKDTXFS |
| Ga0182216_10035384 | 3300017693 | Switchgrass Phyllosphere | MFGLVTYEIXKDTPQFETIMRAKDSFLKIKDLSSLKCHKEMKDTXFS |
| Ga0182216_10951211 | 3300017693 | Switchgrass Phyllosphere | MISLVSYKMXKETPQFKTTMRAKDSILKIKDLSSLKCHKEMK |
| Ga0182216_11849221 | 3300017693 | Switchgrass Phyllosphere | MIILVSYEMXKETPQFGTIMRAKDSISKIKDLSSLKCH |
| Ga0182211_11167811 | 3300017694 | Switchgrass Phyllosphere | VFEGKLMVNLVSYEMXKETLQFKTTMRAKGSISKIKDLSSLKCHKEMKDTXFS |
| Ga0182211_11531691 | 3300017694 | Switchgrass Phyllosphere | MIRLFSYEIXKDTPQFETIMRAKDSFLKIKDLSSLKC |
| Ga0213504_1013812 | 3300022466 | Switchgrass Phyllosphere | EKLMINLVSYEMRKETHQFGTTMRAKDSILKVKDLSSLKCHKEMKDTXFR |
| Ga0207641_122114981 | 3300026088 | Switchgrass Rhizosphere | ILVSHEMQKETPQFGTSMRAKDSILKVKDLSSLKCHKEMKDT |
| Ga0268322_10521911 | 3300028049 | Phyllosphere | MINLVPYEMXKETPQFGTIMRAKDSISKIKDLSSLKC |
| Ga0268306_10170471 | 3300028054 | Phyllosphere | MIRLVSYEIXNETPQFETIMRANDSISKIKDLSSLMCHKEMKD |
| Ga0268330_10017761 | 3300028056 | Phyllosphere | MXKETPQFRTTMRAKDSISKIKDLSRLKCHKEMKG |
| Ga0268345_10172281 | 3300028144 | Phyllosphere | EMXKETPQFGTTMRANDSILKIKDLSCLKCHKEMKDTXFS |
| Ga0268327_10083661 | 3300028475 | Phyllosphere | LSLVXNVKGDPSIQTIMRAKDSFLKIKDIFSVKCHKEMKDTXFS |
| Ga0268327_10190381 | 3300028475 | Phyllosphere | EMXKETPQFGTIMRAKDSISKIKDLSSLKCHKEMKDT |
| Ga0268327_10238981 | 3300028475 | Phyllosphere | MISLVSYEMXKETPQFKTIMRAKDSISKIKDLSSLRYHKEM |
| Ga0214492_10002141 | 3300032464 | Switchgrass Phyllosphere | MIRLVSYEIXNETPQFETIMRAKDLISKIKDLSSLKCHKEMKDT |
| Ga0214493_10286733 | 3300032465 | Switchgrass Phyllosphere | MIGLVSYEMXKETPQFESIMRDKDLISKIKDLSSLKCHKEMKDTXFS |
| Ga0214503_10432811 | 3300032466 | Switchgrass Phyllosphere | MISLVSYEIXKETPQFKIIMHVKDSFSMIKDLSSLKCHKVM |
| Ga0214488_10619712 | 3300032467 | Switchgrass Phyllosphere | MIRLISYEMXKETPQFGTTMRAKDSILKIKDLSSLKCHKETKDTXFS |
| Ga0214482_10476301 | 3300032468 | Switchgrass Phyllosphere | MKYEIXKETPQFKSNMHVKDSISKIKDLSSLKCNKEMKDT |
| Ga0214490_10237991 | 3300032502 | Switchgrass Phyllosphere | MKCEKETPQFVTTMRAKDSISKIKDLSSLKCYKEMKDT |
| Ga0214490_11150761 | 3300032502 | Switchgrass Phyllosphere | LVSYEMXKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDTXFS |
| Ga0214501_12367661 | 3300032625 | Switchgrass Phyllosphere | EIXKETPQFETIMRTKDSIXKIKDLSSLKCHKEMKDTXLS |
| Ga0214499_12409291 | 3300032697 | Switchgrass Phyllosphere | EKSIIRLVSYEIXNETPQFETILRAKGSILKIKDLSSLKCHKDEGHLI |
| Ga0314754_10024252 | 3300032760 | Switchgrass Phyllosphere | MISLVSYEIXKETPQFKIIMHVKDSFSMIKDLSSLKCHKVMKD |
| Ga0314744_10004894 | 3300032792 | Switchgrass Phyllosphere | MINLVSYEMXKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKD |
| Ga0314745_10185071 | 3300032812 | Switchgrass Phyllosphere | MIRLVSYEIXNETPQFETIMRAKDLISKIKDISSLKCHKEMKDT |
| Ga0314724_1059981 | 3300032825 | Switchgrass Phyllosphere | MISLVSYEIXKETPQFKIIMHVKDSFSMIKDLSSL |
| Ga0314736_10495261 | 3300032843 | Switchgrass Phyllosphere | MIRLVSYEIXNETPQFETIMRAKDLISKIKDLSSLKCHK |
| Ga0314743_10533371 | 3300032844 | Switchgrass Phyllosphere | INLVSYEMXKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDTXFS |
| Ga0314743_11507441 | 3300032844 | Switchgrass Phyllosphere | INLVSYEMXKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKNTXFS |
| Ga0314751_10978201 | 3300032889 | Switchgrass Phyllosphere | MIKLVSYEMRKETPQFGTTMRAKDSILKIKDLSSLK |
| Ga0314747_10645651 | 3300032890 | Switchgrass Phyllosphere | MIRLVSYEIXNETPQFETIMRAKDLISKIKDLSSLK |
| Ga0314739_10973942 | 3300032913 | Switchgrass Phyllosphere | LIXNEIXNETPQFETIMRAKDSISKIKDLSSLKCHKEMKDT |
| Ga0314749_10947652 | 3300032915 | Switchgrass Phyllosphere | GLVSYEISKETPQFEAIMRAKDSIXKIKDLSSLKCHKEMKYTXFS |
| Ga0314741_10372111 | 3300032934 | Switchgrass Phyllosphere | MIRLVSYEIXNETPQFETIMRAKDLILKIKDISSLKCHKEMKDTXLS |
| Ga0314752_10366053 | 3300032976 | Switchgrass Phyllosphere | LVSYEIXKETPQFKIIMHVKDSFSMIKDLSSLKCHKVMKDTXFS |
| Ga0314761_10329712 | 3300033526 | Switchgrass Phyllosphere | MIRLVSYEIXNETPQFETIMHDKDLISKIKDLSSLKCHKEMKD |
| Ga0314770_12167621 | 3300033533 | Switchgrass Phyllosphere | MISLVSYEIXKETPQFKIIMHVKDSFSMIKDLSSLKCHKVMKDT |
| ⦗Top⦘ |