NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066838

Metagenome / Metatranscriptome Family F066838

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066838
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 90 residues
Representative Sequence VGSEYFINSQELEDKVRNLLPSQGGAGAGFDLSASTQIIPVIDLTESAEGSNLRQDLQTSLSHGSVTSFNVVNTTTTIISNTGY
Number of Associated Samples 101
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 96.83 %
% of genes near scaffold ends (potentially truncated) 97.62 %
% of genes from short scaffolds (< 2000 bps) 88.10 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified viruses (99.206 % of family members)
NCBI Taxonomy ID 12429
Taxonomy All Organisms → Viruses → unclassified viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(38.889 % of family members)
Environment Ontology (ENVO) Unclassified
(82.540 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(83.333 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.29%    β-sheet: 0.00%    Coil/Unstructured: 85.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.21 %
UnclassifiedrootN/A0.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10046480All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1761Open in IMG/M
3300000116|DelMOSpr2010_c10065150All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1510Open in IMG/M
3300000949|BBAY94_10160007All Organisms → Viruses → unclassified viruses → Circular genetic element sp.610Open in IMG/M
3300001589|JGI24005J15628_10048048All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1666Open in IMG/M
3300004829|Ga0068515_106150All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1526Open in IMG/M
3300006345|Ga0099693_1041261All Organisms → Viruses → unclassified viruses → Virus sp.784Open in IMG/M
3300006947|Ga0075444_10216680All Organisms → Viruses → unclassified viruses → Circular genetic element sp.766Open in IMG/M
3300006990|Ga0098046_1094130All Organisms → Viruses → unclassified viruses → Virus sp.667Open in IMG/M
3300007231|Ga0075469_10212890All Organisms → Viruses → unclassified viruses → Circular genetic element sp.514Open in IMG/M
3300007344|Ga0070745_1030545All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2318Open in IMG/M
3300007346|Ga0070753_1062226All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1508Open in IMG/M
3300007538|Ga0099851_1229337All Organisms → Viruses → unclassified viruses → Circular genetic element sp.669Open in IMG/M
3300007542|Ga0099846_1275334All Organisms → Viruses → unclassified viruses → Virus sp.580Open in IMG/M
3300007542|Ga0099846_1344725All Organisms → Viruses → unclassified viruses → Circular genetic element sp.505Open in IMG/M
3300009420|Ga0114994_10624492All Organisms → Viruses → unclassified viruses → Circular genetic element sp.706Open in IMG/M
3300009428|Ga0114915_1096079All Organisms → Viruses → unclassified viruses → Circular genetic element sp.886Open in IMG/M
3300009432|Ga0115005_11302404All Organisms → Viruses → unclassified viruses → Virus sp.592Open in IMG/M
3300009436|Ga0115008_10757484All Organisms → Viruses → unclassified viruses → Circular genetic element sp.709Open in IMG/M
3300009445|Ga0115553_1241101All Organisms → Viruses → unclassified viruses → Circular genetic element sp.710Open in IMG/M
3300009512|Ga0115003_10865874All Organisms → Viruses → unclassified viruses → Virus sp.525Open in IMG/M
3300009526|Ga0115004_10060930All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2381Open in IMG/M
3300009526|Ga0115004_10466994All Organisms → Viruses → unclassified viruses → Virus sp.747Open in IMG/M
3300009786|Ga0114999_10951878All Organisms → Viruses → unclassified viruses → Circular genetic element sp.624Open in IMG/M
3300009794|Ga0105189_1022128All Organisms → Viruses → unclassified viruses → Circular genetic element sp.606Open in IMG/M
3300010297|Ga0129345_1130719All Organisms → Viruses → unclassified viruses → Virus sp.914Open in IMG/M
3300010392|Ga0118731_108802098All Organisms → Viruses → unclassified viruses → Virus sp.654Open in IMG/M
3300010430|Ga0118733_108295059All Organisms → Viruses → unclassified viruses → Circular genetic element sp.537Open in IMG/M
3300011013|Ga0114934_10538679All Organisms → Viruses → unclassified viruses → Virus sp.515Open in IMG/M
3300011255|Ga0151667_1092812All Organisms → Viruses → unclassified viruses → Virus sp.662Open in IMG/M
3300012953|Ga0163179_11988997All Organisms → Viruses → unclassified viruses → Virus sp.535Open in IMG/M
3300017709|Ga0181387_1031212All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1045Open in IMG/M
3300017709|Ga0181387_1137428All Organisms → Viruses → unclassified viruses → Virus sp.505Open in IMG/M
3300017710|Ga0181403_1094817All Organisms → Viruses → unclassified viruses → Circular genetic element sp.623Open in IMG/M
3300017710|Ga0181403_1105610All Organisms → Viruses → unclassified viruses → Virus sp.589Open in IMG/M
3300017710|Ga0181403_1131632All Organisms → Viruses → unclassified viruses → Circular genetic element sp.522Open in IMG/M
3300017717|Ga0181404_1026149All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1501Open in IMG/M
3300017720|Ga0181383_1012167All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2303Open in IMG/M
3300017724|Ga0181388_1099172All Organisms → Viruses → unclassified viruses → Circular genetic element sp.693Open in IMG/M
3300017724|Ga0181388_1123289All Organisms → Viruses → unclassified viruses → Circular genetic element sp.617Open in IMG/M
3300017725|Ga0181398_1138913All Organisms → Viruses → unclassified viruses → Circular genetic element sp.578Open in IMG/M
3300017726|Ga0181381_1009476All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2304Open in IMG/M
3300017729|Ga0181396_1114975All Organisms → Viruses → unclassified viruses → Virus sp.553Open in IMG/M
3300017730|Ga0181417_1142688All Organisms → Viruses → unclassified viruses → Virus sp.578Open in IMG/M
3300017733|Ga0181426_1006523All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2288Open in IMG/M
3300017733|Ga0181426_1038587All Organisms → Viruses → unclassified viruses → Circular genetic element sp.941Open in IMG/M
3300017738|Ga0181428_1058879All Organisms → Viruses → unclassified viruses → Circular genetic element sp.896Open in IMG/M
3300017738|Ga0181428_1091700All Organisms → Viruses → unclassified viruses → Virus sp.710Open in IMG/M
3300017739|Ga0181433_1127685All Organisms → Viruses → unclassified viruses → Virus sp.606Open in IMG/M
3300017742|Ga0181399_1066732All Organisms → Viruses → unclassified viruses → Circular genetic element sp.918Open in IMG/M
3300017742|Ga0181399_1166405All Organisms → Viruses → unclassified viruses → Circular genetic element sp.525Open in IMG/M
3300017744|Ga0181397_1034841All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1433Open in IMG/M
3300017744|Ga0181397_1154341All Organisms → Viruses → unclassified viruses → Circular genetic element sp.586Open in IMG/M
3300017745|Ga0181427_1010817All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2288Open in IMG/M
3300017745|Ga0181427_1119868All Organisms → Viruses → unclassified viruses → Circular genetic element sp.642Open in IMG/M
3300017748|Ga0181393_1087757All Organisms → Viruses → unclassified viruses → Circular genetic element sp.810Open in IMG/M
3300017757|Ga0181420_1236912All Organisms → Viruses → unclassified viruses → Virus sp.521Open in IMG/M
3300017758|Ga0181409_1174041All Organisms → Viruses → unclassified viruses → Virus sp.626Open in IMG/M
3300017758|Ga0181409_1245904All Organisms → Viruses → unclassified viruses → Virus sp.508Open in IMG/M
3300017759|Ga0181414_1023795All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1670Open in IMG/M
3300017759|Ga0181414_1097376All Organisms → Viruses → unclassified viruses → Circular genetic element sp.774Open in IMG/M
3300017760|Ga0181408_1107312All Organisms → Viruses → unclassified viruses → Virus sp.725Open in IMG/M
3300017760|Ga0181408_1152766All Organisms → Viruses → unclassified viruses → Virus sp.594Open in IMG/M
3300017765|Ga0181413_1118672All Organisms → Viruses → unclassified viruses → Virus sp.803Open in IMG/M
3300017765|Ga0181413_1187081All Organisms → Viruses → unclassified viruses → Virus sp.620Open in IMG/M
3300017765|Ga0181413_1202889All Organisms → Viruses → unclassified viruses → Circular genetic element sp.592Open in IMG/M
3300017767|Ga0181406_1034373All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1585Open in IMG/M
3300017767|Ga0181406_1241105All Organisms → Viruses → unclassified viruses → Circular genetic element sp.532Open in IMG/M
3300017768|Ga0187220_1041279All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1390Open in IMG/M
3300017770|Ga0187217_1303890All Organisms → Viruses → unclassified viruses → Virus sp.513Open in IMG/M
3300017772|Ga0181430_1138846All Organisms → Viruses → unclassified viruses → Virus sp.709Open in IMG/M
3300017773|Ga0181386_1134574All Organisms → Viruses → unclassified viruses → Virus sp.760Open in IMG/M
3300017776|Ga0181394_1257447All Organisms → Viruses → unclassified viruses → Circular genetic element sp.521Open in IMG/M
3300017779|Ga0181395_1148887All Organisms → Viruses → unclassified viruses → Circular genetic element sp.738Open in IMG/M
3300017781|Ga0181423_1243798All Organisms → Viruses → unclassified viruses → Virus sp.672Open in IMG/M
3300017781|Ga0181423_1302365All Organisms → Viruses → unclassified viruses → Virus sp.589Open in IMG/M
3300017781|Ga0181423_1357135All Organisms → Viruses → unclassified viruses → Virus sp.531Open in IMG/M
3300017786|Ga0181424_10224895All Organisms → Viruses → unclassified viruses → Virus sp.790Open in IMG/M
3300020400|Ga0211636_10035041All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2196Open in IMG/M
3300020420|Ga0211580_10033633All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2217Open in IMG/M
3300020422|Ga0211702_10026129All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1580Open in IMG/M
3300020428|Ga0211521_10086185All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1539Open in IMG/M
3300020437|Ga0211539_10508517All Organisms → Viruses → unclassified viruses → Virus sp.501Open in IMG/M
3300021371|Ga0213863_10342273All Organisms → Viruses → unclassified viruses → Virus sp.616Open in IMG/M
3300022050|Ga0196883_1042663All Organisms → Viruses → unclassified viruses → Circular genetic element sp.551Open in IMG/M
3300022055|Ga0224898_100011All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2303Open in IMG/M
3300022065|Ga0212024_1001825All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2304Open in IMG/M
3300022068|Ga0212021_1011385All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1525Open in IMG/M
3300022072|Ga0196889_1008451All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2301Open in IMG/M
3300022074|Ga0224906_1020760All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2357Open in IMG/M
(restricted) 3300024518|Ga0255048_10370715All Organisms → Viruses → unclassified viruses → Circular genetic element sp.693Open in IMG/M
3300025079|Ga0207890_1032245All Organisms → Viruses → unclassified viruses → Circular genetic element sp.954Open in IMG/M
3300025168|Ga0209337_1267480All Organisms → Viruses → unclassified viruses → Circular genetic element sp.642Open in IMG/M
3300025168|Ga0209337_1270347All Organisms → Viruses → unclassified viruses → Virus sp.637Open in IMG/M
3300025630|Ga0208004_1029977All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1604Open in IMG/M
3300025630|Ga0208004_1051353All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1111Open in IMG/M
3300025653|Ga0208428_1018215All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2339Open in IMG/M
3300025769|Ga0208767_1280574All Organisms → Viruses → unclassified viruses → Circular genetic element sp.501Open in IMG/M
3300025810|Ga0208543_1126214All Organisms → Viruses → unclassified viruses → Circular genetic element sp.604Open in IMG/M
3300025830|Ga0209832_1217453All Organisms → Viruses → unclassified viruses → Circular genetic element sp.527Open in IMG/M
3300025869|Ga0209308_10367838All Organisms → Viruses → unclassified viruses → Circular genetic element sp.581Open in IMG/M
3300025892|Ga0209630_10092561All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1653Open in IMG/M
3300026460|Ga0247604_1067670Not Available843Open in IMG/M
3300027522|Ga0209384_1141683All Organisms → Viruses → unclassified viruses → Circular genetic element sp.533Open in IMG/M
3300027668|Ga0209482_1023571All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2603Open in IMG/M
3300027686|Ga0209071_1129954All Organisms → Viruses → unclassified viruses → Circular genetic element sp.725Open in IMG/M
3300027780|Ga0209502_10383393All Organisms → Viruses → unclassified viruses → Circular genetic element sp.581Open in IMG/M
3300027791|Ga0209830_10429806All Organisms → Viruses → unclassified viruses → Virus sp.555Open in IMG/M
3300028008|Ga0228674_1215819All Organisms → Viruses → unclassified viruses → Circular genetic element sp.610Open in IMG/M
3300028671|Ga0257132_1097262All Organisms → Viruses → unclassified viruses → Circular genetic element sp.629Open in IMG/M
3300029753|Ga0135224_1023249All Organisms → Viruses → unclassified viruses → Virus sp.630Open in IMG/M
3300030720|Ga0308139_1014590All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1106Open in IMG/M
3300031252|Ga0307494_1001718All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1741Open in IMG/M
3300031252|Ga0307494_1026763All Organisms → Viruses → unclassified viruses → Circular genetic element sp.607Open in IMG/M
3300031519|Ga0307488_10321383All Organisms → Viruses → unclassified viruses → Circular genetic element sp.988Open in IMG/M
3300031519|Ga0307488_10375958All Organisms → Viruses → unclassified viruses → Circular genetic element sp.887Open in IMG/M
3300031519|Ga0307488_10645532All Organisms → Viruses → unclassified viruses → Virus sp.607Open in IMG/M
3300031519|Ga0307488_10710933All Organisms → Viruses → unclassified viruses → Virus sp.567Open in IMG/M
3300031569|Ga0307489_10330616All Organisms → Viruses → unclassified viruses → Circular genetic element sp.995Open in IMG/M
3300031570|Ga0308144_1019072All Organisms → Viruses → unclassified viruses → Circular genetic element sp.870Open in IMG/M
3300031655|Ga0308018_10234721All Organisms → Viruses → unclassified viruses → Circular genetic element sp.617Open in IMG/M
3300031658|Ga0307984_1016814All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2541Open in IMG/M
3300031676|Ga0302136_1205983All Organisms → Viruses → unclassified viruses → Virus sp.578Open in IMG/M
3300031688|Ga0308011_10196925All Organisms → Viruses → unclassified viruses → Circular genetic element sp.607Open in IMG/M
3300031706|Ga0307997_10154808All Organisms → Viruses → unclassified viruses → Circular genetic element sp.875Open in IMG/M
3300032373|Ga0316204_11050301All Organisms → Viruses → unclassified viruses → Circular genetic element sp.573Open in IMG/M
3300033742|Ga0314858_033853All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1191Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater38.89%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.29%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.90%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.14%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine5.56%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.17%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.38%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.38%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.59%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.79%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.79%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic0.79%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.79%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.79%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.79%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.79%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.79%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.79%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.79%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.79%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.79%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water0.79%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.79%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.79%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.79%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300006345Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075mEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300009794Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245EnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300011255Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, permeateEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020400Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992)EnvironmentalOpen in IMG/M
3300020420Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142)EnvironmentalOpen in IMG/M
3300020422Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022055Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026460Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028671Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029753Marine harbor viral communities from the Indian Ocean - SRH3EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031252Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SW 0.2EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031655Marine microbial communities from water near the shore, Antarctic Ocean - #282EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031676Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20mEnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031706Marine microbial communities from David Island wharf, Antarctic Ocean - #36EnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1004648013300000115MarineMGQEYFINDQTLEDKVRQLLPSQGGAGAGFDLSASTQIIPIVDLTESAEGSNIRQDLQTALSFSSATAFRAINSTETIINNTGYYRVFGGASAYGSVKLEIQA
DelMOSpr2010_1006515013300000116MarineMAQEFFIKSENLETQVRKLLPSQGGLGAGFDLSASTQIIPIIDLTESAEGSVLRSDLQTAYGYETSFLTGTGSSGTQTIVNNTGY
BBAY94_1016000713300000949Macroalgal SurfaceMGQEFFINSTNLEDKVRKLLPSQGGAGAGFDLSGSTQIIPVIDLTETASGGLTRQDLQSALSFSSSARFIAENSTATPTVSAGWYRFDFVSSILSS
JGI24005J15628_1004804853300001589MarineMAQEYFINSRTLEDKIRQVLPSQGGAGAGFDLSASTQIIPIIDLTETSDGSVLREDLQTAMSHDSMTVFNIVNTTTTIVSNTGYWRVFGSASMRATSASITGCSF
Ga0068515_10615043300004829Marine WaterMAQEYFINSQELENKIRQLLPSQGGSGAGVDLSASTQIVPIIDLTEQAEGSNVRQDLQTAFSFKSVTSFAVSNTTTDIVNNT
Ga0099693_104126113300006345MarineMGQEFFINNQELEDKVRQLLPSQGGSGAGFDLSASTQIVPIVDLTESAEGSNLRSDLQSALSHSISSFEVINTTTTIISNTGYFRVFGIMSCNGSTNADSAVNISITDG
Ga0075444_1021668013300006947MarineVAQEFFINSQTLEDKVRNLLPSQGGAGAGFDLSASTQIIPIIDLTESAQGSNLRQDLQTSFSHNDVTAYSVSNATNTTIVNNTGY
Ga0098046_109413013300006990MarineVGQEYFINSSTLEDKIRQVLPSQGGAGAGFDLSASTQIIPIIDVTESAEGSVLRQDLQSALGFDITSFEVTNATNTTIINTTGYWRIF
Ga0075469_1021289013300007231AqueousVGSEYFINSQELEDKVRNLLPSQGGAGAGFDLSASTQIIPVIDLTESAEGSNLRQDLQTSLSHGSVTSFNVVNTTTTIISNTGYYRIFGALSAISPTS
Ga0070745_103054533300007344AqueousVGSEYFINSQELEDKVRNLLPSQGGAGAGFDLSASTQIIPVIDLTESAEGSNLRQDLQTSLSHGSVTSFNVVNTTTTIISNTGYYRIFGALSAICPTSSDEVNI*
Ga0070753_106222653300007346AqueousVGSEYFINSQELEDKVRNLLPSQGGAGAGFDLSASTQIIPVIDLTESAEGSNLRQDLQTSLSHGSVTSFNVVNTTTTIISNTGY
Ga0099851_122933723300007538AqueousVGQEFFVKSTTLEDKVRQILPSQGGLGAGFDLSASTQIIPIVDLTESAEGSTLREDLQKSLTHANSNPFSITNATTTIISNTGY
Ga0099846_127533413300007542AqueousLGQEFIINSAALENKINQLLPSQGGKGAGFDLSASTQIVPIVDLTETAEGSEVRQDLQTAFSHNSITAFAGAAASQTIITTTGYFRVFGTANFNATAANIAFTLTD
Ga0099846_134472523300007542AqueousMGQEYFINSQELQDKVAELLPSQGGAGSGVDLSASTQIIPIIDLTESAQGSNLRQDLQSSFSHGTITPFDVNNTTTTVINN
Ga0114994_1062449233300009420MarineMGSEYFINNQELENKVRQLLPSQGGAGAGFDLSASTQIIPIIDLTESAQGSNLREDLQTALSLTTANAFQVSNAATTVIVN
Ga0114915_109607913300009428Deep OceanVAQEFFINSQTLEDQVRKLLPSQGGQGAGFDLSASTQIIPIIDLTESAEGSNVRADLQTSLSYDSVTAYEVINTTTTIINNTGYFRVFGNVVAQGTG
Ga0115005_1130240423300009432MarineMSQEYFINSQSLEDQIRKLLPSQGGAGAGFDLSASTQIIPIIDVTESAEGSNLRQDLQTALSHNSITVFNINNATRTVLITNTGYYKVYGMSNIGAD
Ga0115008_1075748433300009436MarineMGQEYFINSEELESKIRQLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRADLQTAYSFDKSTEVSCTNATVTVANSP
Ga0115553_124110123300009445Pelagic MarineVGSEYFINSQELENKVRNLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRADLQTALSFNTSSVYSVSNQTTTLITTTGYYRVFGDYRAS
Ga0115003_1086587423300009512MarineMGSEYFINNQQLEDKVRKLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNLRQDLQTSLSHNSITSFSVSNATTTVINNTGYYRVKGIVYGRAVSGT
Ga0115004_1006093033300009526MarineMGQEFFINSQELEDKIRQLLPSQGGAGSSFDLSASTQIVPIIDLTESAEGSGLRADLQTSLSHGSCTELSVQSTTPNFISWTGYW*
Ga0115004_1046699423300009526MarineMAQEYFINSQTLEDTIRQLLPSQGGAGAGFDLSASTQIIPIIDVTPSAEGSLLRQDLQTSISHDNNTSFNVNNATPTLINNTGYWRITGTISGITRSSGVELCEIQI
Ga0114999_1095187823300009786MarineMAQEFFINSQELEDKIRQLLPSQGGAGAGFDLSASTQIIPIIDLTESASGSNLRQDLQSSLSHNSVTSFSVSNATTT
Ga0105189_102212823300009794Marine OceanicMAQEFFIKSTDLEDKIRQLLPSQGGLGAGFDLSASTQIVPIVDLTESAEGSNLREDLQSAISFDTATEFDVSNASTTII
Ga0129345_113071913300010297Freshwater To Marine Saline GradientLGQEFIINSAALENKINQLLPSQGGKGAGFDLSASTQIVPIVDLTETAEGSEVRQDLQTAFSHNSITAFAGAAASQTIITTTGYFRV
Ga0118731_10880209813300010392MarineVGQEYFINSQQLENKVRNLLPSQGGSGAGFDLSASTQIIPIIDLTESAEGSNLRQDLQTSLSFNSITSFGVSNTTTDLIINTGYYRVFGTATVASDDIRCCFQLYD
Ga0118733_10829505923300010430Marine SedimentVASEYFINSQELEDKVRNLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNLRQDLQTSFSHDAVTTFSVNNTTTD
Ga0114934_1053867923300011013Deep SubsurfaceMGQEFFIRSDNLESKVRTLLPSQGGLGAGFDLSASTQIVPIVDLTESAEGSNFRQDLQTALSFDSANTFATTNATDDIVTNTG
Ga0151667_109281213300011255MarineLAQEFFIKSADLENKVRQLLPSQGGLGAGFDLSASTQIVPIIDLTESAEGSNLRQDLQKALSTAGTSYTATSTTTVFNNTGFVRNFGTVY
Ga0163179_1198899713300012953SeawaterMGQEYFINSQNLENKIRELLPSQGGAGAGFDLSASTQIIPVINLTESAEGSNLREDLQTSLSFNTANAFQVSNSTVSVITTTGYFRIFGSNAIKTRASTQDSAS
Ga0181387_103121233300017709SeawaterVGSEYFINSQELEDKVRNLLPSQGGAGAGFDLSASTQIIPIVDLTESAEGSNVRADIQTAFSHTNITSYLVNNTTSTLVN
Ga0181387_113742813300017709SeawaterVAQEFFINSQELESKIRQLLPSQGGGGAGVDLSASTQIVPIVDLTEQAEGSNVRPDLQTALSHDTVTSFAVRNTTTTIINNTGYFRVF
Ga0181403_109481723300017710SeawaterMAQEFFINSQELEDKIRQLLPSQGGQGAGFDLSATTQIVPIIDLTESAEGSNVRADLQTALSQTSVTEFRIINASNTTIVNNT
Ga0181403_110561023300017710SeawaterMAQEYFINSQELEDKIRQLLPTQGGAGAGFDLSASTQIVPIIDLTESAEGSNVRQDLQTALSLNDITSFNTSGETITIVNNTGYYRIFGTVNASGTGSSVL
Ga0181403_113163213300017710SeawaterVGSEYFINSQELQDKVANLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVREDLQSALFFGGVTEFDVTNT
Ga0181404_102614943300017717SeawaterMGQEYFINSQELESKVRDLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRADLQTALSLTSITSFDVSNTTT
Ga0181383_101216753300017720SeawaterMGQEFFINSQELEDKIRQLLPSQGGAGAGFDLSASTQIIPVIDLTESAEGSNVRADLQTAISFNTATAFNVNNATTSVIVNTGYWRIIGTCN
Ga0181388_109917223300017724SeawaterMAQEFFINSQELEDKIRQLLPSQGGQGAGFDLSATTQIVPIIDLTESAEGSNVRADLQTALSQTSVTEFRIINASNTTIVN
Ga0181388_112328913300017724SeawaterMGQEYFINSQTLEDKIRQTLPSQGGAGAGFDLSASTQIIPVIDVTETAEGSTLRQDLQSSFSHGSVTEFSVANTTTTLINNTGYYRVFGN
Ga0181398_113891313300017725SeawaterVGQEYFINSQELQTKVANLLPSQGGAGAGFDLSASTQIVPIIDLTESAEGSNVRQDLQTAFSFKDLTFNEITNATTTFISNT
Ga0181381_100947613300017726SeawaterMGQEYFINDQNLENKVRQLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVREDLQRALSFDSATVFSVQDATSTVITNTGY
Ga0181396_111497513300017729SeawaterVAQEYFINSQELQDKIDSLLPSQGGAGAGFDLSASTQIIPIVDLTESAQGSNLRQDLQRSLSHDSITPFNVVNTTTTIVNNTGYFRVFGTLSANTPAASKEAYFA
Ga0181417_114268813300017730SeawaterMAQEYFINSQELEDKIRQLLPTQGGAGAGFDLSASTQIVPIIDLTESAEGSNVRQDLQTALSLNDITSFNTSGETITIVNNTGYYRIFGTVNASGTGSSVLKL
Ga0181426_100652313300017733SeawaterMGQEYFINSQELEDKIRQLLPSQGGAGAGVDLSASTQIVPIIDLTESAEGSNVRADLQSALSLSTATAFAIDNANTNIITNTGYFRIIAS
Ga0181426_103858713300017733SeawaterVGSEYFINNQELEDKVRNLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRADLQTSLSFNSVTSFSVSDATTTVIT
Ga0181428_105887913300017738SeawaterMAQEFFINSQELEDKIRQLLPSQGGQGAGFDLSATTQIVPIIDLTESAEGSNVRADLQTALSQTSVTEFRIFNASNTTI
Ga0181428_109170023300017738SeawaterMGQEYFINSQSLEDKVRNLLPSQGGAGAGFDLSASTQIIPIVDLTESAEGSNLRSDLQTSFSFTSLTNTQIVNATNTVIVNNTGYFR
Ga0181433_112768513300017739SeawaterMGQEFFINSAQLEEKVRTLLPSQGGSGAGFDLSASTQIIPVIDLTESAEGSNLRQDLQTALSLSSCTTFDASNATVTVVNNTGYFRIF
Ga0181399_106673233300017742SeawaterMGQEYFINDQNLENKVRQLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVREDLQRALSFDSATVFSVQD
Ga0181399_116640523300017742SeawaterMGQEYFINSQELESKVRDLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRADLQTALSLTSITSFLIPSSLLSVSEDIDLF
Ga0181397_103484133300017744SeawaterMAQEFFINSQELEDKIRQLLPSQGGQGAGFDLSATTQIVPIIDLTESAEGSNVRADLQTALSQTSVTEFRIINASNTTIVNNTGYY
Ga0181397_115434113300017744SeawaterMGQEYFINSQTLEDKIRQTLPSQGGAGAGFDLSASTQIIPVIDVTETAEGSTLRQDLQSSFSHGSVTEFSVANTTTTLINNTGY
Ga0181427_101081753300017745SeawaterMGQEYFINSQELEDKIRQLLPSQGGAGAGVDLSASTQIVPIIDLTESAEGSNVRADLQSALSLSTATAFAIDNANTNIITNTGYFRIIASFRL
Ga0181427_111986813300017745SeawaterVESLSVGSEYFINNQELEDKVRNLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRADLQTSLSFNSVTSFSVSDATTTVIT
Ga0181393_108775733300017748SeawaterMGQEFFINSQELEDKIRQLLPSQGGAGAGFDLSASTQIIPVIDLTESAEGSNVRADLQTAISFNTATAFNVNNATTSVIVNTGYWRIIGTCNSISNA
Ga0181420_123691223300017757SeawaterMGQEFFINSQELEDKVNKLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNLRQDLQTSMSHLSTPFGVVNPTTTIISTTGELRILGAVSCNDS
Ga0181409_117404123300017758SeawaterVGSEYFINSQELQDKVANLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVREDLQSALFFGGVTEFDVTNTTTTVITNTGYWRITGSSSIVTSAGNELNE
Ga0181409_124590423300017758SeawaterMGSEYFINSQDLEDQVRKLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGANLRQDLQRSISFKNVTSFDITNSATTVVNTTGFFRILGSGSNEGGAEGLIQINDGA
Ga0181414_102379513300017759SeawaterMGQEYFINSQELEDKIRQLLPSQGGAGAGVDLSASTQIVPIIDLTESAEGSNVRADLQSALSLSTATAFAIDNANTNIITNTGY
Ga0181414_109737633300017759SeawaterVGSEYFINSQELEDKVRNLLPSQGGAGAGFDLSASTQIVPIIDLTESAEGSNVRADLQTALSFASATFTSTDNATNTIISNTGYYRIFGNSHLTGAGQCIIQA
Ga0181408_110731233300017760SeawaterMGQEYFINDQTLENKVRELLPSQGGAGAGFDLSASTQIIPIVDLTESAEGSNLRQDLQKALSLTSITAFDVSDTTSTIVNNTGYFRVF
Ga0181408_115276623300017760SeawaterVAQEYFINSQELQDKIDSLLPSQGGAGAGFDLSASTQIIPIVDLTESAQGSNLRQDLQRSLSHDSITPFNVVNTTTTIVNNTGYFRIFGTYNILGSGTAKMQFTDG
Ga0181413_111867213300017765SeawaterVGQEYFINSQELENKVRELLPSQGGAGAGFDLSASTQIIPIIDLTEQAEGSNVRQDLQTALSFSTITNFNVSNTTTTILNNTGYFRIFGNYQGVTAGGDRDSEFVI
Ga0181413_118708113300017765SeawaterMGQEFFINSQQLQNKISSLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNFREDLQRSFSFKSITRFNINNQTSTIINTTGYFRLFGSTYIT
Ga0181413_120288923300017765SeawaterMGQEFFIKSSNLEDKVRNLLPSQGGLGAGLDLSASTQIVPIVDLTESAEGSNLRQDLQTSFGFNSETYTVFNTTTTIISTT
Ga0181406_103437313300017767SeawaterMGQEYFINSQELESKVRDLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNLRADLQSAFSHKSITAFAISGSTADIVTTTGYYRVFGIFS
Ga0181406_124110523300017767SeawaterLGQEYFINDQTLEDKVRQLLPSQGGAGAGFDLSASTQIIPIVDLTESAEGSNLRGDLQTAFSHDSMTSFAIGGATTTII
Ga0187220_104127913300017768SeawaterLGQEYFINSQELEDKVRQLLPSQGGAGAGFDLSASTQVIPIIDLTESAEGSNVRQDLQTAFSLTSITAFNVVNTTTTLVNNTGYFRVFGANYINV
Ga0187217_130389023300017770SeawaterVGQEFFINSQELEDKVRQLLPSQGGAGAGFDLSASSQIIPIIDLTESAEGSNLREDLQTSLSFDSSTAFSVTGATSTIINNTGYFRIFGNAIL
Ga0181430_113884613300017772SeawaterVGQEFFINSQELEDKVRQLLPSQGGAGAGFDLSASSQIIPIIDLTESAEGSNVRQDLQTAISLNDITAYNTSNETITVVSSTGYFRIFGTINC
Ga0181386_113457413300017773SeawaterMGQEFFINSQELENKIRQLLPSQGGAGAGFDLSASTQIVPIIDLTESAEGSNVRADLQSALSFNDVTVFEIAGSSNTDIITTTGYWRIFGNCN
Ga0181394_125744713300017776SeawaterVGQEFFINSATLEAKVRELLPSQGGAGAGFDLSASTQIIPVINLTESAEGSNLRQDLQSALSHDTATEFSVAGGSFSPISGTGYFRIIGTATSLME
Ga0181395_114888733300017779SeawaterMAQEYFINSQELEDKIRQLLPTQGGAGAGFDLSASTQIVPIIDLTESAEGSNVRQDLQSSLSHGSVSEFSVANTTTTLIN
Ga0181423_124379823300017781SeawaterVGQEYFINNQELENKVRDLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRADLQSALYFGGATVFNVSNGTTTVINTTGYW
Ga0181423_130236513300017781SeawaterMGQEYFINSQELESKVRSLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNLRQDLQSSLKFNSETFNITSATNTTIINTTGYFR
Ga0181423_135713513300017781SeawaterVGSEYFINSQELENKVRNLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNFRQDLQTSLSLKTITAFSVENSTSTIINNTGYYR
Ga0181424_1022489523300017786SeawaterVGQEFFINSQELESKVRQLLPSQGGAGAGFDLSASTQIVPIIDLTESAEGSNIRQDLQTALSHASVTSFNVTNTTTSIVINTGYFRCFGVYSCEEGNAT
Ga0211636_1003504153300020400MarineLGQEFFINNQTLENKVRELLPSQGGAEAGFDLSASTQIQPIIDLTESAQGSNVRADLQSAFSFDTITSFDVSSTTTTI
Ga0211580_1003363353300020420MarineMGQEFFINSQSLQSKVDQLLPSQGGLGSGFDLSASTQIVPIVDLTESAEGSSVRPDLQTALSHATVTAFSVSNTTTTIINNT
Ga0211702_1002612913300020422MarineMGQEFLINSELLQQKIRELLPSQGGLGAGQDLSASTQIIPVVDLTETAEGSTLREDLQRSLSHDTSTAFSVTNTTSTLL
Ga0211521_1008618513300020428MarineVGQEFFINSQALEDKIRTSLPSQGGAGAGFDLSASTQIIPIIDLTETASGSVLRQDLQTSFSLASITEFSVNNTTTTLVNTTGYWRCFVNVTLNTGGFGE
Ga0211539_1050851723300020437MarineMAQEFFINSEELESKIRQLLPSQGGKGAGFDLSASTQIVPIVDLTESAEGSNLRQDLQSSFGLDNTNAFLTSGSTTTLITTTGYWRV
Ga0213863_1034227323300021371SeawaterVAQEYFINSQELQDKIDSLLPSQGGAGAGFDLSASTQIIPIVDLTESAQGSNLRQDLQRSLSHDSITPFNVVNTTTTIVNNTGYYRVFGTLSANTPAASKEAYFALND
Ga0196883_104266313300022050AqueousMGQEYFINDQNLENKVRELLPSQGGRGAGFDLSASTQIIPIVDLTESAEGSNLRQDLQRALSLTSITAFSVANTTSTIVNNTG
Ga0224898_10001113300022055SeawaterLGQEYFINSTQLEDKIRDLLPSQGGAGAGFDLSASTQIIPVIDVTESAQGSNLRVDLQTSYGFNSEVREVVNGTDILLTTTGYFRLFGHYRALSTSNTA
Ga0212024_100182553300022065AqueousLAQEYFINDETLQSKIRDLLPSQGGLGAGFDLSASTQIVPIVDLTESAEGSNVRQDLQTAFGYNNSNSFDLVNVTKQDIITNTGYYKIQGYCNIQS
Ga0212021_101138543300022068AqueousMGQEYFINSQELQNKVNSLLPSQGGAGAGFDLSASTQIVPIIDLTESAQGSNVPQDLQTAYSHTNSDHQTITNTTTTLIVNTG
Ga0196889_100845153300022072AqueousVGSEYFINSQELEDKVRNLLPSQGGAGAGFDLSASTQIIPVIDLTESAEGSNLRQDLQTSLSHGSVTSFNVVNTTTTIISNTGYYRK
Ga0224906_102076053300022074SeawaterMGQEYFINSQELESKVRSLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNLRQDLQSSLKFNSETFNITSATNTTII
(restricted) Ga0255048_1037071523300024518SeawaterVGQEFFINSETLETKVRQLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRADLQTAFSFQTWTRVNTSNATDTIANS
Ga0207890_103224533300025079MarineMAQEYFINSRTLEDKIRQVLPSQGGAGAGFDLSASTQIIPIIDLTESSDGSVLREDLQTAMSHDSMTVFNIINTTT
Ga0209337_126748023300025168MarineLGQEYFINSQELESKVRTLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSSLRADLQTSISFGSSTAFNVVGATSTVISNTGYFRIFGTNTVETDSGGDRTCNHI
Ga0209337_127034723300025168MarineMGQEYFINSQELENKIRQLLPSQGGAGAGFDLSASTQIIPVIDVTESAEGSDLRADLQSSFSHGSITSFAVTGGSGTLITNTGYFRVFGNSTILSSSGSRDNQFTISDGA
Ga0208004_102997713300025630AqueousLAQEYFINDETLQSKIRDLLPSQGGLGAGFDLSASTQIVPIVDLTESAEGSNVRQDLQTAFGYNNSNSFDLVNVTKQDIITNTG
Ga0208004_105135313300025630AqueousVGSEYFINSQELEDKVRDLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNLRQDLQSSFSLKSITHTETINATNNLVTNTGYFR
Ga0208428_101821513300025653AqueousLAQEFFIKSADLEAKIRQLLPSQGGLGAGQDLTATTQIVPIVDLTETAEGSNVRADLQTAFSHNNSNIVETTNTTNTLI
Ga0208767_128057413300025769AqueousMAQEYFINSATLEEKVRKILPSQGGAEAGFDLSASTQIIPIVDLTESSEGSTLREDLQTSFSHDAITSTVVAGASNTVLINNTGYWR
Ga0208543_112621413300025810AqueousVGSEYFINSQELEDKVRDLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNLRQDLQSSFSLKSITHTETINATNNLVTNTGY
Ga0209832_121745323300025830Pelagic MarineVGSEYFINSQELENKVRELLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRADLQTSLSFGTATPYSVS
Ga0209308_1036783823300025869Pelagic MarineMILELLELLDVEYLSVGSEYFINSQNLENKVRDLLPSQGGAGSGFDLSASTQIIPIIDLTESAEGSNLRQDLQTAMSLSSITSFSITNATNTDIITNT
Ga0209630_1009256143300025892Pelagic MarineVGSEYFINSQELENKVRELLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRQDLQTSFTLDNITDFSIIETSADIVSNTGYWRVFGTSYNIMSS
Ga0247604_106767033300026460SeawaterMAQEFSINSSALESKINQLLPSQGGFGAGVDLSASTQIIPIVDLTESAEGSNVRADLQTAFSFKTVSAFNIINTTTTII
Ga0209384_114168323300027522MarineVGQEFFINSQALEDKVSALLPSQGGRGAGFDLSASTQIIPIIDLTESAEGANVRQDLQTAFSFNSVTSFSVTNATTNIIVN
Ga0209482_102357163300027668MarineVGQEFFINSQTLEDKVRTLLPSQGGRGAGFDLSASTQIIPIIDLTESAEGSNLRQDLQKSFSFTNISFFNVNNTTTTIINNTGYFRLFGSTYITGGGFINVRITDG
Ga0209071_112995423300027686MarineVGQEFFINSQALEDKVSALLPSQGGRGAGFDLSASTQIIPIIDLTESAEGANVRQDLQTAFSFNSVTSFSVTNATTNIIVNTGYFRVFGSFNNRSSTSADFS
Ga0209502_1038339323300027780MarineMGQEFFINSQELEDKIRQLLPSQGGAGSSFDLSASTQIVPIIDLTESAEGSGLRADLQTSLSHGSCTEFNVVNTTT
Ga0209830_1042980623300027791MarineVGQEFFINNQSLEDKIRQLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRVDLQTAFSHKTIETFSVINQTTSLIVNTGYFRVFGNITQ
Ga0228674_121581913300028008SeawaterVGSEYFINSQELEDKVRTLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNIREDLQRSLSFSSTTPFNVQGATSTIINNTGYWRIFGINTLK
Ga0257132_109726223300028671MarineMGQEFFINSQELENKIRQLLPSQGGAGAGFDLSASTQIVPIIDLTESAEGSNVRADLQSALSFNDVTVFEIAGSSNTDIITTTGY
Ga0135224_102324923300029753Marine HarborMGQEFFIKSADLESKVRELLPSQGGLGAGFDLTGSTQIIPIVDLTESAQGSNLRQDLQRAYGIKSETFDVSNATTTIITTTGYFRL
Ga0308139_101459033300030720MarineVGQEFFINSQDLENKIRQLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNIRADLQSALSHKTITSFAVINATTTIISNTGYFRVFGFMSGNGS
Ga0307494_100171843300031252Sackhole BrineLGQEYFINSQDLESTVRKLLPSQGGAGAGIDLSASTQIIPIIDLTPTAEGSILRQDLQTSSSLTTITSFNIANANSTDLIINTGYWLV
Ga0307494_102676323300031252Sackhole BrineMGSEYFINNQELEDKIRTLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRQDLQTALSLTTVTAFSITNATSTIINNTG
Ga0307488_1032138333300031519Sackhole BrineMGQEFFINSQTLEDQVRKLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSGLRQDLQTAVSNSVVNVTSSASTVDLVINTGFWRIFGGTIRDTASGSATVSL
Ga0307488_1037595813300031519Sackhole BrineVGQEFFINSQELQDKVDKLLPSQGGAGAGFDLSASTQIIPIIDLTESAQGSDVRADLQTSLSLSSVTAFNISNTSGTIISNTGYFRV
Ga0307488_1064553213300031519Sackhole BrineMGQEFFINSQELENKIRQLLPSQGGAGSGFDLSASTQIIPIIDLTESAEGSNVREDLQSSLSFDLVSSFAITNTTTTIINNTGYYR
Ga0307488_1071093323300031519Sackhole BrineMAQEFFINSQTLEDQIRKLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNVRQDIQSAFSHASITSFNVGNATTTLISNTGYFRVFGSMSQATADTCNFSLSDGTTDKI
Ga0307489_1033061613300031569Sackhole BrineVGQEFFINSQGLEDKVRQLLPSQGGSGAGIDLSGSTQIIPIIDLTESAQGGNTRVDLQTALSFTTSTPFLVANAETTLVNNTGYWRVFGTMTTINVANVNSN
Ga0308144_101907233300031570MarineMGQEYFINNQTLEDQIRQLLPSQGGAGSGLDLSASTQIIPIIDVTPSAEGSNLRQDLQTAVSLSTTNVETANATATIISNTGFFEVTCNINNRAGT
Ga0308018_1023472123300031655MarineMGQEFFINSQELENKIRTLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSGVRQDLQTSLSHKSITTFNVTNTT
Ga0307984_101681413300031658MarineVAQEFFINSQTLEDQIRKLLPSQGGQGAGFDLSASTQIVPIIDLTESAEGSNIRQDIQTAISHGSATTFNVDNTTTT
Ga0302136_120598323300031676MarineMGSEYFINSQELEDKIRTLLPTQGGAGAGFDLSASTQIIPIIDLTESAEGSNLRVDLQTAMDFATDYNLVNAGTTTLITTTGFFRVFGTSVRGNAP
Ga0308011_1019692523300031688MarineVAQEFFINSQKLEDKIRTLLPSQGGFGAGFDLSASTQIIPIIDLTDSSEDTTLRQDIQSASSFANVNAFSVNGNATLLSTTGYFKIIGTGY
Ga0307997_1015480833300031706MarineMGQEFFINSQKLEDQVRKLLPSQGGQGAGVDLSASTQIIPIIDLTESAEGSGLRQDLQTSLGFKDITSFFVTGATTTIINNTGYFRIFG
Ga0316204_1105030123300032373Microbial MatVGQEYFINSQELEDKIRSLLPSQGGAGAGFDLSASTQIIPVIDVTESAEGSNLRQDLQSSLSLDSATAFEVSNASTTIINNTGYFRVFGSATLVTNTG
Ga0314858_033853_909_11903300033742Sea-Ice BrineMGQEFFINSQDLEDKVRKLLPSQGGAGAGFDLSASTQIIPIIDLTESAEGSNLREDLQTSLSFDSITAFSINGGTNTVIINNTGYYRVFGIILT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.