Metagenome / Metatranscriptome Family F062002

Overview

Basic Information

• Family ID: F062002
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 131
• Average Sequence Length: 38 residues
• Representative Sequence: MSTRRDFRAMTREAVQASAGAALILGGLLLLSAP
• Number of Associated Samples: 105
• Number of Associated Scaffolds: 131

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 69.53 %
• % of genes near scaffold ends (potentially truncated): 23.66 %
• % of genes from short scaffolds (< 2000 bps): 69.47 %
• Associated GOLD sequencing projects: 101
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (54.962 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.397 % of family members)
• Environment Ontology (ENVO): Unclassified (22.137 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (58.015 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 48.39%
  β-sheet: 0.00%
  Coil/Unstructured: 51.61%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 131 Family Scaffolds
PF00682	HMGL-like	44.27
PF03976	PPK2	18.32
PF08502	LeuA_dimer	8.40
PF01161	PBP	2.29
PF02567	PhzC-PhzF	1.53
PF01450	IlvC	1.53
PF07813	LTXXQ	1.53
PF03358	FMN_red	0.76
PF00884	Sulfatase	0.76
PF02738	MoCoBD_1	0.76
PF10369	ALS_ss_C	0.76
PF02082	Rrf2	0.76
PF02452	PemK_toxin	0.76
PF01566	Nramp	0.76
PF00230	MIP	0.76
PF01494	FAD_binding_3	0.76
PF05015	HigB-like_toxin	0.76
PF01042	Ribonuc_L-PSP	0.76
PF02775	TPP_enzyme_C	0.76
PF10077	DUF2314	0.76
PF03401	TctC	0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 131 Family Scaffolds
COG2326	Polyphosphate kinase 2, PPK2 family	Energy production and conversion [C]	18.32
COG0119	Isopropylmalate/homocitrate/citramalate synthases	Amino acid transport and metabolism [E]	8.40
COG3678	Periplasmic chaperone Spy, Spy/CpxP family	Posttranslational modification, protein turnover, chaperones [O]	6.11
COG0059	Ketol-acid reductoisomerase	Amino acid transport and metabolism [E]	3.05
COG1881	Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family	General function prediction only [R]	2.29
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.53
COG0384	Predicted epimerase YddE/YHI9, PhzF superfamily	General function prediction only [R]	1.53
COG1914	Mn2+ or Fe2+ transporter, NRAMP family	Inorganic ion transport and metabolism [P]	0.76
COG3549	Plasmid maintenance system killer protein	Defense mechanisms [V]	0.76
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.76
COG2524	Predicted transcriptional regulator, contains C-terminal CBS domains	Transcription [K]	0.76
COG2378	Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains	Transcription [K]	0.76
COG2337	mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module	Defense mechanisms [V]	0.76
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.76
COG2188	DNA-binding transcriptional regulator, GntR family	Transcription [K]	0.76
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	0.76
COG1959	DNA-binding transcriptional regulator, IscR family	Transcription [K]	0.76
COG1725	DNA-binding transcriptional regulator YhcF, GntR family	Transcription [K]	0.76
COG1414	DNA-binding transcriptional regulator, IclR family	Transcription [K]	0.76
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.76
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.76
COG0640	DNA-binding transcriptional regulator, ArsR family	Transcription [K]	0.76
COG0580	Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)	Carbohydrate transport and metabolism [G]	0.76
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.76

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	60.31 %
Unclassified	root	N/A	39.69 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	60.31 %
Unclassified	root	N/A	39.69 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	54.96 %
Unclassified	root	N/A	39.69 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	5.34 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	40.46 %
Unclassified	root	N/A	39.69 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	5.34 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	5.34 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	32.82 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	4.58 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	22.14 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	4.58 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4.58 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4.58 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	3.05 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	0.76 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	4.58 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	3.05 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.76 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	0.76 %
Rhodovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	4.58 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	0.76 %
unclassified Rhodovulum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.69 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	5.34 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	4.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.53 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.76 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.76 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.76 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000567|JGI12270J11330_10018900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4315
3300000574|JGI1357J11328_10016687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3793
3300000956|JGI10216J12902_118885829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	1333
3300001169|JGI12661J13543_104794	Not Available	536
3300001661|JGI12053J15887_10141774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1269
3300002245|JGIcombinedJ26739_101690070	Not Available	532
3300003996|Ga0055467_10265676	Not Available	544
3300004082|Ga0062384_100773888	All Organisms → cellular organisms → Bacteria	668
3300004082|Ga0062384_101489177	All Organisms → cellular organisms → Bacteria	501
3300005533|Ga0070734_10296442	All Organisms → cellular organisms → Bacteria	925
3300005538|Ga0070731_10000673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	42123
3300005538|Ga0070731_10023698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4215
3300005538|Ga0070731_10117227	All Organisms → cellular organisms → Bacteria → Proteobacteria	1764
3300005542|Ga0070732_10000417	All Organisms → cellular organisms → Bacteria → Proteobacteria	27721
3300005568|Ga0066703_10160446	Not Available	1353
3300005591|Ga0070761_10053956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2264
3300005602|Ga0070762_10019998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3484
3300005602|Ga0070762_10122678	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1528
3300005610|Ga0070763_10412795	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	761
3300005712|Ga0070764_10075544	All Organisms → cellular organisms → Bacteria	1765
3300005712|Ga0070764_10967114	Not Available	536
3300005712|Ga0070764_11039034	Not Available	517
3300005764|Ga0066903_100398962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2261
3300005921|Ga0070766_10676145	Not Available	697
3300006028|Ga0070717_11487060	Not Available	614
3300006057|Ga0075026_100851650	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	557
3300006176|Ga0070765_100878040	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	848
3300006844|Ga0075428_100123221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2822
3300006846|Ga0075430_100000254	All Organisms → cellular organisms → Bacteria → Proteobacteria	37136
3300006853|Ga0075420_100246478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1553
3300006854|Ga0075425_100927941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	995
3300006893|Ga0073928_10312582	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1176
3300006893|Ga0073928_10439718	Not Available	946
3300006893|Ga0073928_10540315	All Organisms → cellular organisms → Bacteria	830
3300006894|Ga0079215_11338445	Not Available	555
3300006904|Ga0075424_100924229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	931
3300007982|Ga0102924_1001044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	32673
3300007982|Ga0102924_1007029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	10419
3300009147|Ga0114129_10289144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2188
3300009147|Ga0114129_11011871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1046
3300009162|Ga0075423_12074237	Not Available	616
3300009521|Ga0116222_1009838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4527
3300009523|Ga0116221_1263645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	745
3300009623|Ga0116133_1136107	Not Available	638
3300009632|Ga0116102_1036048	All Organisms → cellular organisms → Bacteria → Proteobacteria	1625
3300009633|Ga0116129_1203728	Not Available	561
3300009698|Ga0116216_10695866	Not Available	611
3300009764|Ga0116134_1033974	All Organisms → cellular organisms → Bacteria	2008
3300009789|Ga0126307_10023615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4675
3300009792|Ga0126374_11489609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	555
3300009824|Ga0116219_10068974	All Organisms → cellular organisms → Bacteria → Proteobacteria	2078
3300009840|Ga0126313_10334065	Not Available	1191
3300010044|Ga0126310_10011221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4180
3300010045|Ga0126311_10120205	Not Available	1832
3300010050|Ga0133945_100004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1221605
3300010371|Ga0134125_10350812	Not Available	1637
3300010379|Ga0136449_100036579	All Organisms → cellular organisms → Bacteria → Proteobacteria	11604
3300010379|Ga0136449_100432676	All Organisms → cellular organisms → Bacteria → Proteobacteria	2317
3300010379|Ga0136449_100658680	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1768
3300010379|Ga0136449_100876862	All Organisms → cellular organisms → Bacteria	1467
3300010876|Ga0126361_10478576	Not Available	618
3300010938|Ga0137716_10372403	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	704
3300011083|Ga0138560_1124892	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	604
3300011411|Ga0153933_1021815	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1535
3300012363|Ga0137390_11018963	Not Available	779
3300014151|Ga0181539_1000938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	33807
3300014168|Ga0181534_10773669	Not Available	566
3300014168|Ga0181534_10860421	Not Available	540
3300014169|Ga0181531_10169980	All Organisms → cellular organisms → Eukaryota → Viridiplantae	1320
3300014201|Ga0181537_10011421	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	6577
3300014201|Ga0181537_10212447	Not Available	1329
3300014489|Ga0182018_10000138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	91014
3300014493|Ga0182016_10054472	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3084
3300014495|Ga0182015_10518360	Not Available	761
3300014501|Ga0182024_10117090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	3824
3300014501|Ga0182024_10173636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2987
3300014501|Ga0182024_10343796	All Organisms → cellular organisms → Bacteria → Proteobacteria	1952
3300014501|Ga0182024_10390133	Not Available	1805
3300014501|Ga0182024_11322914	Not Available	834
3300014638|Ga0181536_10092706	All Organisms → cellular organisms → Bacteria → Proteobacteria	1744
3300014638|Ga0181536_10142968	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1271
3300014657|Ga0181522_10107957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1611
3300014657|Ga0181522_10400741	Not Available	820
3300014838|Ga0182030_11133330	Not Available	675
3300015206|Ga0167644_1004533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	7952
3300017925|Ga0187856_1012415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	4779
3300017941|Ga0187850_10242110	Not Available	813
3300017948|Ga0187847_10019749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4181
3300017948|Ga0187847_10240061	Not Available	987
3300018020|Ga0187861_10108248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1330
3300018085|Ga0187772_10278773	Not Available	1141
3300018085|Ga0187772_11149644	Not Available	571
3300018429|Ga0190272_11541933	Not Available	678
3300018468|Ga0066662_12365149	Not Available	559
3300019876|Ga0193703_1005632	Not Available	1825
3300020582|Ga0210395_10839294	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	684
3300021081|Ga0210379_10214709	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	831
3300021171|Ga0210405_10202380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1574
3300021178|Ga0210408_10000008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	328608
3300021401|Ga0210393_10237792	All Organisms → cellular organisms → Bacteria	1476
3300021402|Ga0210385_10318953	All Organisms → cellular organisms → Bacteria	1155
3300021404|Ga0210389_11370433	All Organisms → cellular organisms → Bacteria	540
3300021405|Ga0210387_11663432	Not Available	541
3300021420|Ga0210394_10062427	Not Available	3236
3300021432|Ga0210384_10878926	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	796
3300021433|Ga0210391_10664749	All Organisms → cellular organisms → Bacteria	817
3300021474|Ga0210390_11153508	Not Available	627
3300027652|Ga0209007_1022434	Not Available	1628
3300027678|Ga0209011_1023266	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2000
3300027826|Ga0209060_10290197	All Organisms → cellular organisms → Bacteria	747
3300027842|Ga0209580_10000045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	138351
3300027869|Ga0209579_10035807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2690
3300027909|Ga0209382_10866905	Not Available	954
3300027909|Ga0209382_10905985	Not Available	928
3300028746|Ga0302233_10115359	Not Available	1051
3300028808|Ga0302228_10265434	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	772
3300029999|Ga0311339_11218874	Not Available	688
3300030977|Ga0265721_1020642	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	502
3300031236|Ga0302324_102781515	Not Available	589
3300031525|Ga0302326_11803318	Not Available	801
3300031708|Ga0310686_101384218	Not Available	2077
3300031708|Ga0310686_102485147	Not Available	527
3300031708|Ga0310686_105873251	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1338
3300031719|Ga0306917_10519468	Not Available	935
3300032000|Ga0310903_10244974	Not Available	860
3300032783|Ga0335079_11449158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	680
3300032895|Ga0335074_10061435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	5122
3300034163|Ga0370515_0237007	Not Available	775

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	91.60%
Host-Associated	Host-Associated	8.40%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	66.41%
Aquatic	Environmental → Aquatic	25.19%
Plants	Host-Associated → Plants	7.63%
Fungi	Host-Associated → Fungi	0.76%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	62.60%
Freshwater	Environmental → Aquatic → Freshwater	18.32%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.63%
Thermal Springs	Environmental → Aquatic → Thermal Springs	4.58%
Peat	Environmental → Terrestrial → Peat	3.82%
Marine	Environmental → Aquatic → Marine	0.76%
Sediment	Environmental → Aquatic → Sediment	0.76%
Unclassified	Environmental → Aquatic → Unclassified	0.76%
Mycelium	Host-Associated → Fungi → Mycelium	0.76%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	38.17%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	16.03%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	12.21%
Loam	Environmental → Terrestrial → Soil → Loam	12.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.63%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	4.58%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.82%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.53%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.76%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.76%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.76%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.76%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.76%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.19%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	12.98%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	11.45%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	9.16%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.63%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	6.87%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.34%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	3.82%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.82%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	3.05%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.29%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.53%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	0.76%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.76%
Neutral	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral	0.76%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.76%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.76%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.76%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.76%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.76%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.76%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.40%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	7.63%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	7.63%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.63%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	6.87%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	6.11%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.58%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	3.82%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	3.82%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	3.82%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	3.82%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	3.82%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	3.05%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	3.05%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.29%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.53%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	1.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.53%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.53%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	1.53%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	1.53%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	0.76%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.76%
Hot Spring Fe-Si Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment	0.76%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.76%
Xenic Strain	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Xenic Strain	0.76%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.76%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.76%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.76%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.76%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.76%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.76%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.76%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.76%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.76%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.76%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.76%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.76%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000567	Peat soil microbial communities from Weissenstadt, Germany - SII-2010	Environmental
3300000574	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300001169	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2	Environmental
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental
3300003996	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2	Environmental
3300004082	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3	Environmental
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental
3300005712	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300007982	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG	Environmental
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009521	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG	Environmental
3300009523	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG	Environmental
3300009623	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10	Environmental
3300009632	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40	Environmental
3300009633	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10	Environmental
3300009698	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG	Environmental
3300009764	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40	Environmental
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental
3300009824	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG	Environmental
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental
3300010050	Microbial community associated with xenic strain of Nostoc sp. EX-5-1	Environmental
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010379	Sb_50d combined assembly	Environmental
3300010876	Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental
3300010938	Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117	Environmental
3300011083	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2)	Environmental
3300011411	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG	Host-Associated
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental
3300014151	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG	Environmental
3300014168	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG	Environmental
3300014169	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG	Environmental
3300014201	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG	Environmental
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental
3300014493	Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG	Environmental
3300014495	Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG	Environmental
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental
3300014638	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG	Environmental
3300014657	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG	Environmental
3300014838	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)	Environmental
3300015206	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))	Environmental
3300017925	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40	Environmental
3300017941	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150	Environmental
3300017948	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10	Environmental
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental
3300018020	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100	Environmental
3300018085	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG	Environmental
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental
3300019876	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2	Environmental
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental
3300021073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo	Environmental
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental
3300021474	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O	Environmental
3300027652	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)	Environmental
3300027678	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)	Environmental
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300028746	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1	Environmental
3300028808	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2	Environmental
3300029999	I_Palsa_E3 coassembly	Environmental
3300030977	Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI2 (Metagenome Metatranscriptome)	Environmental
3300031236	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1	Environmental
3300031525	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3	Environmental
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental
3300032895	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3	Environmental
3300034163	Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12270J11330_100189005	3300000567	Peatlands Soil	MSTRRDFRAMTREAVQASAGAAFILGGLLLLSAP*
JGI1357J11328_100166871	3300000574	Groundwater	MSTRRDFRAMTRGAIKARPGAALILGGLLLLIVP*
JGI10216J12902_1188858291	3300000956	Soil	MPICRDRRAINRGAEQARSGAALILGGLLLLSVPW
JGI12661J13543_1047942	3300001169	Forest Soil	MSTRRDFRAKTREAVQASAGAALILGGLLLLSAP*
JGI12053J15887_101417742	3300001661	Forest Soil	MANVMLTRCDFRAITRRAQARPGAALILRGLLLLTVP*
JGIcombinedJ26739_1016900701	3300002245	Forest Soil	MSTRCDFRAMTREAVLAAPDAALMDFQLHSQLLGGLLLLIAP*
Ga0055467_102656762	3300003996	Natural And Restored Wetlands	RNEGRAMSTRRDFRAITRGALTARPDAVRILDGLLLLSVP*
Ga0062384_1007738882	3300004082	Bog Forest Soil	MSFRRELRAMTREAQAAEPVAALSGAALGCCQILGGLLLLSVP*
Ga0062384_1014891771	3300004082	Bog Forest Soil	MSTRSDFRAMTGEAVSASSDAALMHFQPHSQFLGGLLLLIAP*
Ga0070734_102964422	3300005533	Surface Soil	MSTRRDIRAMTREAAQAAPGAALMPELLGGLLLLIAP*
Ga0070731_1000067343	3300005538	Surface Soil	MSTRRGFRAMTREAAQAIPGAALILGGLLLLIAP*
Ga0070731_100236982	3300005538	Surface Soil	MSNRSDFRAMTREAQAACSGAALMPCQILGGLLLLSAP*
Ga0070731_101172272	3300005538	Surface Soil	MSTRRDFRAMTREAVQASAGAALILGGLLLLSAP*
Ga0070732_1000041719	3300005542	Surface Soil	MSTRRDLFRAMTREAVQASAGAALILGGFLLLSAP*
Ga0066703_101604461	3300005568	Soil	VMPTRRDIRAITRRGTTPSGAALILGGLLLLSVP*
Ga0070761_100539561	3300005591	Soil	MSTRRDFRAMTREALQASAGAALILGGLLLLSAP*
Ga0070762_100199982	3300005602	Soil	MSDRRDIRAMTRGASKASSGAALLSLLGGLLLLSTP*
Ga0070762_101226781	3300005602	Soil	IHLDPRPLDRNEGLAMSTRRDFRAMTREAVQASAGATLILGGLLLLSAP*
Ga0070763_104127952	3300005610	Soil	MSTRRDFRAMTREAVSAAPGAALMHVQLRSQLLGGLLLLIAP*
Ga0070764_100755443	3300005712	Soil	MSTRRDFRAMTREAVSAAPGAALMHVQLRSQLLDGLLLLIAP*
Ga0070764_109671142	3300005712	Soil	MSTRRDFRAMTRGAVSAAPDAALMHFPLHSQLLGGLLLLIAP*
Ga0070764_110390342	3300005712	Soil	MSTRRDFRAMTREAVSAAPDAALMRFQLHSKLHSQLLGGLLLLIAP*
Ga0066903_1003989622	3300005764	Tropical Forest Soil	VISTRSDFRAIRRRAEARPGAALILGGLLLLTVP*
Ga0070766_106761452	3300005921	Soil	DPRPLDRNEGLAMSTRRDFRAMTREAVQASAGAALILGGLLLLSAP*
Ga0070717_114870602	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	IAVEEGFLAMSIRRDDRAIARGANPGAALILGTLLLLTRP*
Ga0075026_1008516501	3300006057	Watersheds	MSTRRDFRAITRGAEKAQPGAAFILGGLLLLSVP*
Ga0070765_1008780402	3300006176	Soil	MSTRRDFRAMTWEAVSAAPGAALMRFQLLGGLLLLIAP*
Ga0075428_1001232215	3300006844	Populus Rhizosphere	MPICRDSRTINRGAAQARPGAALILGGLLLLSVPWGP*
Ga0075430_1000002549	3300006846	Populus Rhizosphere	MPICRDIRAINRGAFEARSGAAFILGGLLLLSVPWGP*
Ga0075420_1002464781	3300006853	Populus Rhizosphere	MPICRDNRAINRGASKARSGAAFILGGLLLLSVPWGP*
Ga0075425_1009279412	3300006854	Populus Rhizosphere	MRTDVSTRFDIRATDRRASARSDAVLILGGLLLLSVP*
Ga0073928_103125822	3300006893	Iron-Sulfur Acid Spring	MSTRRDFRAMTREAVQASAGAGLILGGLLLLSAP*
Ga0073928_104397183	3300006893	Iron-Sulfur Acid Spring	MSARRDFRAMTREALQASAGAALILGGLLLLSAP*
Ga0073928_105403152	3300006893	Iron-Sulfur Acid Spring	MSPRRDIRAMTRTAVQAWSGAALILGGLLLLSAP*
Ga0079215_113384452	3300006894	Agricultural Soil	MPICRDIRAINRGAKPARPGAALILGGLLLLSVP*
Ga0075424_1009242291	3300006904	Populus Rhizosphere	MSIGRDLRAINRGATKARPGAALILGGFLLLSVP*
Ga0102924_100104415	3300007982	Iron-Sulfur Acid Spring	MSSRRDFRAMTREAQAASPGAALILSGLLLLSTP*
Ga0102924_10070296	3300007982	Iron-Sulfur Acid Spring	MSTRRDFRAMTRTAALAASGAALILGGLLLLIAP*
Ga0114129_102891442	3300009147	Populus Rhizosphere	MSTRRDLRAITRGADAARPGAALILGGLLLLSVP*
Ga0114129_110118712	3300009147	Populus Rhizosphere	MSTRSEIRAITRGADAARPGAALILGGLLLLSVP*
Ga0075423_120742372	3300009162	Populus Rhizosphere	MSIGRDLRAINRGAANARPGAALILGGLLLLSVP*
Ga0116222_10098382	3300009521	Peatlands Soil	MSFRRDLRAMTRGALAVSSGAALILGGLLLLSAP*
Ga0116221_12636452	3300009523	Peatlands Soil	LDGNEGLAMSTRRDFRAMTREAVQASAGAAFILGGLLLLSAP*
Ga0116133_11361072	3300009623	Peatland	MSTRSDFRAMTREAVSAAPDAALMPLLGGLLLLIAP*
Ga0116102_10360483	3300009632	Peatland	LDGNEGLAMSTRRDFRAMIREAVQASAGAAFILGGLLLLSA
Ga0116129_12037282	3300009633	Peatland	MSTRRDFRAMTGEAVSAAPDAALMHFPLHFQLLGGLLLLIAP*
Ga0116216_106958661	3300009698	Peatlands Soil	MSTRRDFRAMTREALQVSAGAALILGGLLLLSAP*
Ga0116134_10339743	3300009764	Peatland	LDGNEGLAMSTRRDFRAMIREAVQASAGAAFILGGLLLLSAP*
Ga0126307_100236152	3300009789	Serpentine Soil	MPICRDFRAITGRAVQARPGAALILGGLLLLSLP*
Ga0126374_114896091	3300009792	Tropical Forest Soil	AVTSVQSDIRAINRGAAAARPGAVRIGGLLLLSVP*
Ga0116219_100689742	3300009824	Peatlands Soil	LDGNEGLAMSTRRDFRAMTREAVQASAGATFILGGLLLLSAP*
Ga0126313_103340652	3300009840	Serpentine Soil	RVAMPICRDFRAITGRAVQARPGAALILGGLLLLSLP*
Ga0126310_100112211	3300010044	Serpentine Soil	MPICRDFRAINRGAAQAQPGAALILGGLLLLIVP*
Ga0126311_101202052	3300010045	Serpentine Soil	MPICRDFRAINRGAVQARPGAALILGGLLLLSVP*
Ga0133945_100004412	3300010050	Xenic Strain	MSAQEFHRATKRGAVDARPGAALILGGILLLTRP*
Ga0074044_100028993	3300010343	Bog Forest Soil	MSPRRDSRAMTRGAVQAKPGAALSGAVLILGGLLLLTAP*
Ga0134125_103508122	3300010371	Terrestrial Soil	VMPTRSDFRAMTRGAQPRPGAALILGGLLLLTLP*
Ga0136449_1000365795	3300010379	Peatlands Soil	MSFRRDFRAMTREALSASSGADLILAGLLLLNAP*
Ga0136449_1004326762	3300010379	Peatlands Soil	MPIRDDSDAIERGARKARPGMALILGGLLLLSAP*
Ga0136449_1006586802	3300010379	Peatlands Soil	MSTRRDFRAMTREAVQVSAGAALILGGLLLLSAP*
Ga0136449_1008768622	3300010379	Peatlands Soil	MSTRRDFRAMTREAVPASAGAALILGGLLLLSAP*
Ga0126361_104785762	3300010876	Boreal Forest Soil	LDGNEGLAMSTRRDFRAMTREALQASAGAALILGGLLLLSAP*
Ga0137716_103724032	3300010938	Hot Spring Fe-Si Sediment	MPTRRDIRAIERGADEARPGAAFILGGLLLLSVP*
Ga0138560_11248921	3300011083	Peatlands Soil	GIHLDPRPSDRNEGLAMSTRRDFRAMTREAVQASAGAAFILGGLLLLSAP*
Ga0153933_10218152	3300011411	Attine Ant Fungus Gardens	MSDRSDIRAMTREAKLAAAGAVLIGKGLLLLSAP*
Ga0137390_110189631	3300012363	Vadose Zone Soil	MSTRRDFFRAMTREGCQARPDAALILGGLLLLLSAP*
Ga0181539_100093818	3300014151	Bog	MSDRGDFRAMTRGALPARSGAAPMLHGILGGLLLLSVP*
Ga0181534_107736691	3300014168	Bog	MSTRRDFRAMTREALKAGPAAVLSGAAFAQRKILGGLLLLSAP*
Ga0181534_108604212	3300014168	Bog	DFRAMTREAVLAAPDAALTHSQLHSQLLGGLLLLIAP*
Ga0181531_101699801	3300014169	Bog	MSTRRDFRAMTREAVLAAPGAAFMPLLGGLLLLIAP*
Ga0181537_100114215	3300014201	Bog	MSTRRDFRAMTRGADAARPGAALVLGGLLLLSAP*
Ga0181537_102124472	3300014201	Bog	MSTRSDFRAMTREAVLAAPDAALTHSQLHSQLLGGLLLLIAP*
Ga0182018_1000013880	3300014489	Palsa	MSTRRNFRAMTRGADQAKPVAALAGAALILGGLLLLSAP*
Ga0182016_100544721	3300014493	Bog	MSTRRDFRAMTRGAEQANPVAAVSGAALALSGIVGAILG
Ga0182015_105183603	3300014495	Palsa	LDRDEGLAMSTRRDFRAMTREAVQAAPGVALIVGGLLLLIAP*
Ga0182024_101170902	3300014501	Permafrost	MSFRRDFRAMTRGAKAAGPGAALILGGLLLLIAP*
Ga0182024_101736363	3300014501	Permafrost	MLNRGDFRAIGRSGAVAASSAALILGGLLLLSAP*
Ga0182024_103437962	3300014501	Permafrost	MSTRRDFRAMTREALQASAGAARILGGLLLLSAP*
Ga0182024_103901332	3300014501	Permafrost	AMSARRDFRAMTREAVQAAPGAALIVDGLLLLIAP*
Ga0182024_113229142	3300014501	Permafrost	MSTRRDFRAMTREAVQAVPGAALILGGLLLLIAP*
Ga0181536_100927063	3300014638	Bog	LDGNEGLAMSTRRDFRAMTREAVQASAGATFILGG
Ga0181536_101429681	3300014638	Bog	MSARRDFRAMNRTADAARSGAALILGGLLLLIAP*
Ga0181522_101079572	3300014657	Bog	MSTRRDFRAMTREALGASAGAALILGGLLLLSAP*
Ga0181522_104007412	3300014657	Bog	VQRVNAEFTSIRDLLDHNEGKAMSTRSDFRAMTGEAVSAAPDAALMPLLGGLLLLIAP*
Ga0182030_111333302	3300014838	Bog	MTRALAMSTRRDFRAMTRGAVSAAPDAALMHFPLHSQFLGGLLLLIAP*
Ga0167644_10045335	3300015206	Glacier Forefield Soil	MSTRRDFRAMTRTAFQATSGAAPMRSKLLGELLLLSAP*
Ga0187856_10124158	3300017925	Peatland	MSTRRDFFRAMTRGALQACSGAALILGGLLLLSAP
Ga0187850_102421102	3300017941	Peatland	LDGNEGLAMSTRRDFRAMIREAVQASAGAAFILGGLLLLSAP
Ga0187847_100197492	3300017948	Peatland	MSTRREFRAMTREAVLAVPVAAFMPLLGGLLLLIAP
Ga0187847_102400611	3300017948	Peatland	MSTRRDFRAMTRGAEQANPVAGVCGAALAVSGILDAILGGL
Ga0187778_105648962	3300017961	Tropical Peatland	VFHDLVRSQDEGEVMSMCRDFRAITRGADEARPGAALILAGLLLLSTP
Ga0187861_101082482	3300018020	Peatland	LDGNEGLAMSTRRDFRAMTREAVQASAGAAFILGGLLLLSAP
Ga0187772_102787732	3300018085	Tropical Peatland	LAGVKRADAMSVRGDIRAMTRTASTAGAGAALILGGLLLLIAP
Ga0187772_111496442	3300018085	Tropical Peatland	MSMRRDLCRAITREAKKPAARGAALILGGLLLLIAP
Ga0190272_115419331	3300018429	Soil	MPIRRDNRAINRGVELAQPGAALILGGLLLLSVPWGP
Ga0066662_123651491	3300018468	Grasslands Soil	VMATRRDFRATTRRALAARPGAALILGGLLLLSVP
Ga0193703_10056321	3300019876	Soil	NVMPTRRDFRAMTRGAQPRPGAALIFGGLLLLILP
Ga0210395_108392942	3300020582	Soil	MSTRRDFRAMTWEAVSAAPGAALMRFQLLGGLLLLIAP
Ga0210378_101422951	3300021073	Groundwater Sediment	HDEGEVMSTRRDFRAITRGADAARPGAALILGGLLLLTVP
Ga0210379_102147091	3300021081	Groundwater Sediment	VTRANVMPTRRDFRAMIRGAQARPGAALILGGLLLLTIP
Ga0210405_102023802	3300021171	Soil	LDGNEGLAMSTRRDFRAMTREAVQASAGAALILGGLLLLSAP
Ga0210408_10000008290	3300021178	Soil	MSTRRDFFRAMTREAVQVRPGAALILGGLLLLSAP
Ga0210393_102377922	3300021401	Soil	LDRNEGKAMSTRRDFRAMTGEAVSASSDAALMHFQPHSQFLGGLLLLIAP
Ga0210385_103189532	3300021402	Soil	MSTRRDFRAMTREAVSAAPDAALMRFQLHSQLHSKLLGGLLLLIAP
Ga0210389_113704332	3300021404	Soil	MSTRRDFRAMTREAVSAAPGAALMHVQLRSQLLGGLLLLIAP
Ga0210387_116634322	3300021405	Soil	MSTRRDFRAMTREAVSAAPGAALMHVQLRSQLLDGLLLLIAP
Ga0210394_100624273	3300021420	Soil	MPFRRDFRAMTREALSASSGAALMHCQMHCKMHCKILGGLLLLSVP
Ga0210384_108789262	3300021432	Soil	LDPRPLDRNEGLAMSTRRDFRAMTREAVQASAGAALILGGLLLLSAP
Ga0210391_106647492	3300021433	Soil	MSTRCDFRAMTREAVLAAPDAALMDFQLHSQFLGGLLLLIAP
Ga0210390_111535081	3300021474	Soil	MSTRRDFRAMTREAVQASAGAALILGGLLLLSAPCGPAGR
Ga0209007_10224342	3300027652	Forest Soil	MSTRCDFRAMTREAVLAAPDAALMDFQLHSQLLGGLLLLIAP
Ga0209011_10232662	3300027678	Forest Soil	MSTRREFFRAMTREAVQASAGAALILGGLLLLSAP
Ga0209060_102901972	3300027826	Surface Soil	MSTRRDIRAMTREAAQAAPGAALMPELLGGLLLLIAP
Ga0209580_1000004596	3300027842	Surface Soil	MSTRRDLFRAMTREAVQASAGAALILGGFLLLSAP
Ga0209579_100358072	3300027869	Surface Soil	MSNRSDFRAMTREAQAACSGAALMPCQILGGLLLLSAP
Ga0209382_108669052	3300027909	Populus Rhizosphere	PICRDSRTINRGAAQARPGAALILGGLLLLSVPWGP
Ga0209382_109059851	3300027909	Populus Rhizosphere	MPICRDSRTINRGPERARPGAALILGGLLLLSVPWG
Ga0302233_101153592	3300028746	Palsa	MSTRSDFRAMTREAVLATPDAAFMPLLGGLLLLIAP
Ga0302228_102654342	3300028808	Palsa	NEGNAMSTRSDFRAMTREAVLATPDAAFMPLLGGLLLLIAP
Ga0311339_112188742	3300029999	Palsa	MSTRRDFRAMTGEAVPASTDAALMHFQLLGGLLLL
Ga0265721_10206422	3300030977	Soil	LAMSTRREFRAMTREVVQASAGAALILGGLLLLSAP
Ga0302324_1027815152	3300031236	Palsa	STRREFRAMTREAVLAVPVAAFMPLLGGLLLLIAP
Ga0302326_118033182	3300031525	Palsa	MSTRFDFRAMTREAVLAAPDAVLMHFQLHTQLHSQFLGGLLLLIAP
Ga0310686_1013842184	3300031708	Soil	MSTRRDFRAMTREAVSAAPGAALMPLLGGLLLLIAP
Ga0310686_1024851472	3300031708	Soil	MSARRDFRAMTREAAKASPAAVLSGCKILGGLLLLSAP
Ga0310686_1058732512	3300031708	Soil	MSTRRDFRAMTRGAVSAAPDAALMHFPLHSQLLGGLLLLIAP
Ga0306917_105194682	3300031719	Soil	GEMPTRRDIRAITRGAQARPGAALILGGLLLLMVP
Ga0310903_102449741	3300032000	Soil	AMPICRDSRTINRGAEQARSGAALILGGLLLLSVPWGP
Ga0335079_114491582	3300032783	Soil	SVMSKRRDDRATTRGAETARPGAALILGGLLLLSTP
Ga0335074_100614352	3300032895	Soil	MSTRRDPFRAMTREAELALSGACLVICKILGGLLLLSTP
Ga0370515_0237007_379_495	3300034163	Untreated Peat Soil	MSTRRDFRAMTGEAVPASTDAALVHFQLLGGLLLLIAP