3300008724: Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone1_mRNA

Overview

Basic Information

• IMG/M Taxon OID: 3300008724
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117975 | Gp0126374 | Ga0103785
• Sample Name: Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone1_mRNA
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Florida
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 25119553
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	3

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Communities Of Thrombolites From Highborne Cay, Bahamas
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → cay → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: Highborne Cay, Bahamas
• Coordinates
  • Lat. (^o): 24.72
  • Long. (^o): -76.82
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022892	Metagenome / Metatranscriptome	212	Y
F027186	Metagenome / Metatranscriptome	195	Y
F060086	Metagenome / Metatranscriptome	133	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0103785_103089	Not Available	792
Ga0103785_104880	Not Available	617
Ga0103785_105520	Not Available	577

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103785_103089	Ga0103785_1030892	F060086	LDSNLLLSSGRHGEDCKRQYIFIYIYVHETPLLIDLADLMY*
Ga0103785_104880	Ga0103785_1048802	F022892	VNKKIKPKANNIGVLNVKEPSHIVAIQLNILIPVGTAIIIVAAVK*
Ga0103785_105520	Ga0103785_1055202	F027186	MTTNSNFNFTNNTAITLELPFSEHIEELRQRIFVVF