NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F063102

Metagenome Family F063102

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063102
Family Type Metagenome
Number of Sequences 130
Average Sequence Length 46 residues
Representative Sequence DSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGTACK
Number of Associated Samples 117
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.98 %
% of genes near scaffold ends (potentially truncated) 76.15 %
% of genes from short scaffolds (< 2000 bps) 74.62 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.462 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(9.231 % of family members)
Environment Ontology (ENVO) Unclassified
(31.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(33.846 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.86%    β-sheet: 0.00%    Coil/Unstructured: 85.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF00211Guanylate_cyc 70.77
PF00498FHA 20.00
PF00069Pkinase 2.31
PF04095NAPRTase 0.77
PF05860TPS 0.77
PF028262-Hacid_dh_C 0.77
PF01476LysM 0.77
PF01791DeoC 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 70.77
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 9.23
COG1488Nicotinic acid phosphoribosyltransferaseCoenzyme transport and metabolism [H] 0.77
COG3210Large exoprotein involved in heme utilization or adhesionIntracellular trafficking, secretion, and vesicular transport [U] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.46 %
UnclassifiedrootN/A21.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000890|JGI11643J12802_11534462All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria771Open in IMG/M
3300004081|Ga0063454_100202596All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1130Open in IMG/M
3300004153|Ga0063455_100531442All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria743Open in IMG/M
3300004808|Ga0062381_10035758All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1349Open in IMG/M
3300005093|Ga0062594_101496880All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria692Open in IMG/M
3300005166|Ga0066674_10207995All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria931Open in IMG/M
3300005178|Ga0066688_10141037All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1504Open in IMG/M
3300005295|Ga0065707_10372349All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria888Open in IMG/M
3300005439|Ga0070711_101098554All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria685Open in IMG/M
3300005451|Ga0066681_10896571All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria532Open in IMG/M
3300005529|Ga0070741_10112213All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2847Open in IMG/M
3300005540|Ga0066697_10835630All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria500Open in IMG/M
3300005547|Ga0070693_100458469All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria896Open in IMG/M
3300005549|Ga0070704_101589750All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria603Open in IMG/M
3300005559|Ga0066700_10214639All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1334Open in IMG/M
3300005559|Ga0066700_11023597All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria542Open in IMG/M
3300005576|Ga0066708_10535599All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria755Open in IMG/M
3300005888|Ga0075289_1085485All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria525Open in IMG/M
3300005904|Ga0075280_10015708All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1277Open in IMG/M
3300006163|Ga0070715_10861011All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria555Open in IMG/M
3300006755|Ga0079222_10762733All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria781Open in IMG/M
3300006755|Ga0079222_11271184All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria667Open in IMG/M
3300006806|Ga0079220_10867516All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria695Open in IMG/M
3300006852|Ga0075433_10672111All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria908Open in IMG/M
3300006853|Ga0075420_101417555All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria596Open in IMG/M
3300006871|Ga0075434_101921944All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria598Open in IMG/M
3300006894|Ga0079215_11459821All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria537Open in IMG/M
3300006903|Ga0075426_10001162All Organisms → cellular organisms → Bacteria → Proteobacteria18511Open in IMG/M
3300006904|Ga0075424_102419093All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria551Open in IMG/M
3300006914|Ga0075436_100158744All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae1594Open in IMG/M
3300006914|Ga0075436_100221513All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1342Open in IMG/M
3300006969|Ga0075419_10060320All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae2392Open in IMG/M
3300009089|Ga0099828_10343753All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1344Open in IMG/M
3300009098|Ga0105245_11611085All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria701Open in IMG/M
3300009678|Ga0105252_10146321All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria982Open in IMG/M
3300010336|Ga0134071_10444364All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria664Open in IMG/M
3300010397|Ga0134124_11228898All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria770Open in IMG/M
3300010399|Ga0134127_10658281All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1083Open in IMG/M
3300010400|Ga0134122_10527512All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1075Open in IMG/M
3300010401|Ga0134121_10272341All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1489Open in IMG/M
3300010403|Ga0134123_11724101All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria678Open in IMG/M
3300010403|Ga0134123_12360275All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria596Open in IMG/M
3300011416|Ga0137422_1006275All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae2690Open in IMG/M
3300011419|Ga0137446_1150948All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria560Open in IMG/M
3300011420|Ga0137314_1142776All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria586Open in IMG/M
3300011430|Ga0137423_1122498All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria779Open in IMG/M
3300012038|Ga0137431_1118248All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria749Open in IMG/M
3300012203|Ga0137399_10692887All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria857Open in IMG/M
3300012469|Ga0150984_117203425All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria779Open in IMG/M
3300012925|Ga0137419_10869845All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria741Open in IMG/M
3300012989|Ga0164305_11506292All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria597Open in IMG/M
3300013308|Ga0157375_11527620All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria788Open in IMG/M
3300014166|Ga0134079_10525722All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria575Open in IMG/M
3300015200|Ga0173480_11159624All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria519Open in IMG/M
3300015245|Ga0137409_10575931All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria954Open in IMG/M
3300015374|Ga0132255_104507790All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria590Open in IMG/M
3300018422|Ga0190265_10814641All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1056Open in IMG/M
3300018466|Ga0190268_11510588All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria584Open in IMG/M
3300018466|Ga0190268_12062014All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria527Open in IMG/M
3300020202|Ga0196964_10123052All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1158Open in IMG/M
3300021066|Ga0196980_1068947All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria605Open in IMG/M
3300021441|Ga0213871_10195210All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria630Open in IMG/M
3300021953|Ga0213880_10046039All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1053Open in IMG/M
3300024330|Ga0137417_1297385All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria624Open in IMG/M
3300025165|Ga0209108_10103654All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1532Open in IMG/M
3300025324|Ga0209640_10217631All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1619Open in IMG/M
3300025885|Ga0207653_10024553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1924Open in IMG/M
3300025908|Ga0207643_10342547All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria937Open in IMG/M
3300025908|Ga0207643_11012596All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria537Open in IMG/M
3300025910|Ga0207684_10501419All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1040Open in IMG/M
3300025912|Ga0207707_10290644All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1414Open in IMG/M
3300025961|Ga0207712_10752451All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria854Open in IMG/M
3300025979|Ga0210078_1022986All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria814Open in IMG/M
3300026067|Ga0207678_10559465All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300026116|Ga0207674_10975726All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria816Open in IMG/M
3300026326|Ga0209801_1109633All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1189Open in IMG/M
3300027462|Ga0210000_1082797All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300027513|Ga0208685_1001103All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria8840Open in IMG/M
3300027513|Ga0208685_1055987All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria852Open in IMG/M
3300027573|Ga0208454_1049383All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria978Open in IMG/M
3300027846|Ga0209180_10677984All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria563Open in IMG/M
3300027876|Ga0209974_10288736All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria625Open in IMG/M
3300027886|Ga0209486_10326794All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria910Open in IMG/M
3300027903|Ga0209488_10722757All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria712Open in IMG/M
3300027907|Ga0207428_10150246All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1773Open in IMG/M
3300028145|Ga0247663_1105227All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria518Open in IMG/M
3300028802|Ga0307503_10233411All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria890Open in IMG/M
3300030511|Ga0268241_10081779All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria730Open in IMG/M
3300030511|Ga0268241_10151002All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria568Open in IMG/M
3300031170|Ga0307498_10454451All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria515Open in IMG/M
3300031576|Ga0247727_10585547All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria843Open in IMG/M
3300031913|Ga0310891_10183073All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria696Open in IMG/M
3300031944|Ga0310884_10875390All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria553Open in IMG/M
3300031965|Ga0326597_10790719All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria985Open in IMG/M
3300032002|Ga0307416_101269096All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria842Open in IMG/M
3300032012|Ga0310902_10503153All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria790Open in IMG/M
3300032174|Ga0307470_11324983All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria591Open in IMG/M
3300032180|Ga0307471_103448945All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria560Open in IMG/M
3300032180|Ga0307471_103471960All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria558Open in IMG/M
3300033417|Ga0214471_10282136All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1353Open in IMG/M
3300033417|Ga0214471_11021796All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria635Open in IMG/M
3300034164|Ga0364940_0258788All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium515Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil9.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.46%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.08%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.31%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.54%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.54%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.54%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.54%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.54%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.54%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.54%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.54%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.77%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.77%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.77%
Hot Spring Water ColumnEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Water Column0.77%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.77%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.77%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.77%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.77%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.77%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.77%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.77%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.77%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.77%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005794Subglacial sediment microbial community from Lake Whillans, Antarctica - at 0-2 cm depthEnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300005904Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009945Combined Assembly of Gp0139326, Gp0139349, Gp0139350, Gp0139351EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011409Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2EnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300011424Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300021066Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_10-13CEnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025979Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300027462Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J12802_1153446223300000890SoilTDSVAEDVEYGFAGEVGTTPPMDHRIDESGISVPRCVQESREGLPCK*
Ga0055498_1004640313300004058Natural And Restored WetlandsVAEQIEYGFAGDVGVLPPIDHRLQGVGISVPKCFNESREGEAC*
Ga0063454_10020259623300004081SoilIDYGFAGDVGTTPPMDHRIDETGISTPDCFDESREGQACKGS*
Ga0063455_10053144223300004153SoilDYGFAGDVGTTPPMDHRIDETGISTPDCLEESREARPCTN*
Ga0062589_10047438223300004156SoilSVAEQVEYGFAGDVGTLPPIDHRLQGVGISVPKCFNESREGDAC*
Ga0062592_10086746423300004480SoilFGTDSVAEQIEYGFAGDVGVLPPIDHRLQGVGISVPKCFNESREGEAC*
Ga0062591_10279902313300004643SoilAEQVEYGFAGDVGTLPPIDHRLQGVGISVPKCFNESREGDAC*
Ga0062381_1003575823300004808Wetland SedimentNKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK*
Ga0062594_10149688013300005093SoilALLESQDTDSVQKQIAYGFAGDVGNTPPMDHRIDETGISVPICFNDSREGQTCR*
Ga0066674_1020799523300005166SoilAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK*
Ga0066688_1014103713300005178SoilQALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCLEESRESRPCKN*
Ga0065707_1037234923300005295Switchgrass RhizosphereDVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK*
Ga0070711_10109855413300005439Corn, Switchgrass And Miscanthus RhizosphereDISRSALLEAQDTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISTPDCFEESREGTACK*
Ga0070694_10071065213300005444Corn, Switchgrass And Miscanthus RhizosphereGTDSVAEQVEYGFAGDVGTLPPMDHRLQGVGISVPKCFNESREGEGC*
Ga0066681_1089657123300005451SoilDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK*
Ga0070741_1011221313300005529Surface SoilVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCLEESREARPCKN*
Ga0066697_1083563023300005540SoilAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGTACK*
Ga0070693_10045846923300005547Corn, Switchgrass And Miscanthus RhizosphereDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVSESREGVPCK*
Ga0070704_10158975023300005549Corn, Switchgrass And Miscanthus RhizosphereTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPECFEESRENNACK*
Ga0066700_1021463933300005559SoilAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCLEESRESRPCKN*
Ga0066700_1102359713300005559SoilGDVGTTPPMDHRIDETGISTPDCFEESREGTACK*
Ga0066708_1053559923300005576SoilAKQIDYGFAGDIGATPPMDHRIDETGISTPDCFEESREGTACK*
Ga0079490_11193813300005794SedimentVAEQIEFGFAGDVGVLPPMDHRLQGGGISVPKCFNESREGENC*
Ga0074479_1103093413300005829Sediment (Intertidal)GDVGTLPPIDHRLQGVGISVPDCFNESREGESCAK*
Ga0074470_1134126513300005836Sediment (Intertidal)DSVAQIIEFGFVGDIGTLPPIDHRLQGVGISVPDCFNESREGEACAR*
Ga0075289_108548523300005888Rice Paddy SoilTDSVQKQIDYGFAGDVGTTPPMDHRIDETGISTPNCFEESRDGEPCRARN*
Ga0075280_1001570823300005904Rice Paddy SoilDTDSVQKQIDYGFAGDVGMTPPMDHRIDDTGISTPHCFEESRDSEACRGN*
Ga0070715_1086101123300006163Corn, Switchgrass And Miscanthus RhizosphereLEAQDTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISVPKCFNDSRDGQTCR*
Ga0075367_1048212623300006178Populus EndosphereIEYGFAGDVGTLPPMDHRLTGVGISVPACFNNSREGEGC*
Ga0079222_1076273313300006755Agricultural SoilALQEALDTDSVQKQIDYGFAGDVGTTPPMDHRIDDTGISTPQCFEQSREGEACTN*
Ga0079222_1127118413300006755Agricultural SoilLKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFDESREGTPCK*
Ga0079220_1086751613300006806Agricultural SoilTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFDESREGQACKAN*
Ga0075433_1067211123300006852Populus RhizosphereDTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISVPKCFNDSREGQICQ*
Ga0075420_10141755523300006853Populus RhizosphereKDAQSTDSVAKQIDYGFAGDIGNTPPMDHRIDETGISTPNCFEESREGVACK*
Ga0075434_10192194423300006871Populus RhizosphereATQDTDSVQKQISYGFVGDVGTTPPMDHRIDETGISVPKCFNDSREGQICQ*
Ga0079215_1145982123300006894Agricultural SoilYGFAGEIGATPPMDHRIDESGISLPRCVQEAREGLPCK*
Ga0075426_1000116213300006903Populus RhizosphereYGFAGDVGTTPPMDHRIDETGISTPECMEESREARPCRN*
Ga0075424_10241909313300006904Populus RhizosphereGDVGTTPPMDHRIDDTGISTPNCFNESREGQDCK*
Ga0075436_10015874433300006914Populus RhizosphereQALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK*
Ga0075436_10022151333300006914Populus RhizosphereYGFVGDVGTTPPMDHRIDETGISVPKCFNDSREGQICQ*
Ga0075419_1006032013300006969Populus RhizosphereADSFSTDSVADQINKGFAGDVGATPPMDHRLEESGISTPECFNEARESVPCK*
Ga0099828_1034375313300009089Vadose Zone SoilAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK*
Ga0105245_1161108513300009098Miscanthus RhizosphereTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPACFEESREGTACK*
Ga0075418_1183377023300009100Populus RhizosphereEYGFAGDVGNLPPIDHRLQGVGISVPKCFNESREGEGC*
Ga0105252_1000560143300009678SoilEANKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPSCVEEAREGLPCK*
Ga0105252_1014632113300009678SoilNKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPHCVQEAREGLPCK*
Ga0117932_112453513300009945Hot Spring Water ColumnFGTDSVAEQIEFGFAGDVSTAPPMAHRLAGTGIGTPECFVESREGEACE*
Ga0099796_1030827513300010159Vadose Zone SoilAQALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESRENTACK*
Ga0134071_1044436413300010336Grasslands SoilALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK*
Ga0134124_1122889813300010397Terrestrial SoilQALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGTACK*
Ga0134127_1065828123300010399Terrestrial SoilAALLDQQDTDSVQNQMSYGFVGDVGTTPPMDHRIDETGISVPICFNDSREGQICR*
Ga0134122_1052751213300010400Terrestrial SoilTDSVQKQIAYGFAGDVGTTPPMDHRIDETGISVPSCFNDSRDGQTCR*
Ga0134122_1318805813300010400Terrestrial SoilQIEYGFAGDVSTAPPMAHRLTGTGIGTPECFAESRDGEPCEP*
Ga0134121_1027234133300010401Terrestrial SoilAQDTDSVQKQIAYGFAGDVGTTPPMDHRIDETGISVPRCFNDSREGQICQ*
Ga0134123_1172410123300010403Terrestrial SoilLEAQDTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISVPKCFNDSREGQACR*
Ga0134123_1236027513300010403Terrestrial SoilQIAAQALAEAQDTDSVQKQIDYGFEGEVGTTPPMDHRIDETGISTPSCFEESREGAACKN
Ga0137323_104726323300011409SoilEANKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPHCVQEAREGLPCK*
Ga0137422_100627533300011416SoilEYGFAGEIGATPPMDHRIDESGISLPSCVEEAREGLPCK*
Ga0137446_115094813300011419SoilKQIKDGFAGDVGTTPPMDHRIDDTGISVPSCFEESREGQGKC*
Ga0137314_114277623300011420SoilAEDVEYGFAGEIGATPPMDHRIDESGISLPHCVEEAREGQPCK*
Ga0137439_107710513300011424SoilVEQQIEYGFAGDVGTLPPIDHRLQGVGISVPNCFNESREGESCAGQPPR*
Ga0137423_112249823300011430SoilFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPSCVEEAREGLPCK*
Ga0137431_111824813300012038SoilEYGFAGEIGATPPMDHRIDESGISLPRCVQEAREGLPCK*
Ga0137399_1069288713300012203Vadose Zone SoilDYGFAGDVGTTPPMDHRIDETGISTPDCFEESRENQACK*
Ga0150984_11720342513300012469Avena Fatua RhizosphereQIDYGFAGDVGTTPPMDHRIDETGISTPECFEESREGTACK*
Ga0157216_1026439423300012668Glacier Forefield SoilTDSVAEQVEYGFAGDVGTLPPMDHRLQGVGISVPKCFNNSREGEGC*
Ga0137419_1086984513300012925Vadose Zone SoilKQIDYGFAGDVGTTPPMDHRIDETGISTPECLEESRESRPCKN*
Ga0137410_1156310923300012944Vadose Zone SoilAAQALKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESRENTACK*
Ga0164305_1150629213300012989SoilTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCLEESREARPCKN*
Ga0157375_1152762013300013308Miscanthus RhizosphereMSYGFVGDVGTTPPMDHRIDETGISVPKCFTDSREGTTCR*
Ga0134079_1052572223300014166Grasslands SoilLKDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK*
Ga0173480_1115962413300015200SoilDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK*
Ga0137409_1057593123300015245Vadose Zone SoilFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK*
Ga0132255_10450779013300015374Arabidopsis RhizosphereANKTFGTDSVAADVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK*
Ga0190265_1081464113300018422SoilEAGDVGVTPPMDHRLDETGISVPECLNESNEGVDCKRPQ
Ga0190268_1151058813300018466SoilSVAEDVEYGFAGEIGATPPMDHRIDESGISLPACVQESRDGVPCK
Ga0190268_1206201413300018466SoilGTDSVAEAVEYGFAGEVGTTPPMDHRIDENGISLPRCVEESREGVPCK
Ga0190274_1022622213300018476SoilGTDSVAEQVEYGFAGDVGTLPPMDHRLQGVGISVPKCFNESREGESC
Ga0173479_1068190813300019362SoilSVAEQIEYGFAGDVGVLPPIDHRLQGVGISVPKCFNESREGEAC
Ga0187892_1044017423300019458Bio-OozeDSVAEQVEFGFAGDVGTLPPFAHRLSGVGLSTPECFVESREGEGC
Ga0196964_1012305223300020202SoilKQIKDGFAGDVGATPPMDHRIDESGISTPECLNEQREGAACP
Ga0196980_106894713300021066SoilDVEYGFAGEIGATPPMDHRIGDSGISVPRCLEEARESLPCK
Ga0213871_1019521013300021441RhizosphereDNNMVGDVGTTPPMDHRLEESGISTPDCMSESKEGAACK
Ga0213880_1004603913300021953Exposed RockSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGAACK
Ga0137417_129738523300024330Vadose Zone SoilFAGDVGTTPPMDHRIDETGISTPECLEESRESRPCKN
Ga0209320_1029631123300025155SoilVAEQIEYGFAGDVGTLPPMDHRLTGVGISVPKCFNESREGEAC
Ga0209108_1010365433300025165SoilVQEANETFGTDSVAEQVEYGFAGDVGTTPPMDHRLDETGISVPACLNESREGLPCK
Ga0209321_1016262823300025312SoilYGFAGDVGTLPPMDHRLQGVGISVPKCFNESREGEAC
Ga0209640_1021763113300025324SoilKDGFAGDVGTTPPMDHRIDDTGISVPRCFEESREGQGKC
Ga0207653_1002455313300025885Corn, Switchgrass And Miscanthus RhizosphereLLESQDTDSVQKQIAYGFAGDVGNTPPMDHRIDESGISLPRCVQESREGVPCK
Ga0207643_1034254713300025908Miscanthus RhizosphereAYGFVGDVGTTPPMDHGIDETGISVPRCFNDSREGQTCR
Ga0207643_1101259623300025908Miscanthus RhizosphereDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK
Ga0207684_1050141923300025910Corn, Switchgrass And Miscanthus RhizosphereSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCLEESREARPCKN
Ga0207707_1029064413300025912Corn RhizosphereDAQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPACFEESREGAACK
Ga0207712_1075245113300025961Switchgrass RhizosphereEANKTFGTDSVAEDVEYGFAGEVGATPPMDHRIDESGISLPRCVQESREGVPCK
Ga0210078_102298623300025979Natural And Restored WetlandsALLEAQDTDSVQKQIAYGFAGDVGTTPPMDHRIDETGISVPICFNDSREGQPCR
Ga0207678_1055946533300026067Corn RhizosphereVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK
Ga0207674_1097572613300026116Corn RhizosphereQSTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPSCFEESREGTACK
Ga0209801_110963323300026326SoilDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPDCFEESREGTACK
Ga0210000_108279723300027462Arabidopsis Thaliana RhizosphereALDTDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPECFDESRENEACK
Ga0208685_100110313300027513SoilNKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPSCVEEAREGLPCK
Ga0208685_105598713300027513SoilFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVQEAREGLPCK
Ga0208454_104938313300027573SoilNKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPHCVQEAREGLPCK
Ga0209180_1067798423300027846Vadose Zone SoilQKQIEYGFAGDVGTTPPMDHRIDETGISVPGCFNESRDGQACK
Ga0209974_1028873613300027876Arabidopsis Thaliana RhizosphereVEYGFAGEIGATPPMDHRIDESGISLPRCVEESREGVPCK
Ga0209486_1032679413300027886Agricultural SoilEQVEYGFAGDVGTTPPMDHRLDETGISVPACLNESREGVPCK
Ga0209488_1072275723300027903Vadose Zone SoilARTSLLASHDTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISVPKCFNDSREGQTCQ
Ga0207428_1015024633300027907Populus RhizosphereNKTFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVQESREGVPCK
Ga0247663_110522723300028145SoilEIARAALLESQDTDSVQKQIAYGFAGDVGNTPPMDHRIDETGISVPICFNDSREGQACR
Ga0307503_1023341113300028802SoilMAYGFSGDVGTTPPMDHRIDETGISVPVCFNDSREGQTCR
Ga0268241_1008177913300030511SoilDAQATDSVAKQIDYGFAGDVGTTPPMDHRIDETGISTPSCFEESREGTACK
Ga0268241_1015100213300030511SoilDTDSVQKQIDYGFAGDVGTTPPMDHRIDETGISTPECFDQSREGEPCR
Ga0307498_1045445123300031170SoilIARAALLESQDTDSVAKQLLYGFAGDVGTTPPMNHQIDDTGISVPGCFNESREGQTCK
Ga0247727_1058554713300031576BiofilmFGTDSVAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVAESREGVPCK
Ga0310891_1018307313300031913SoilAEDVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK
Ga0310884_1087539013300031944SoilAKQIDYGFAGDVGTTPPMDHRIDETGISTPACFEESREGTACK
Ga0326597_1079071913300031965SoilANETFGTDSVAEQVEYGFAGDVGTTPPMDHRLEETGISVPECLNESQEGEPCK
Ga0307416_10126909613300032002RhizosphereEYGFAGEVGATPPMDHRIDESGISLPRCVQESREGLPCK
Ga0310902_1050315313300032012SoilEDVEYGFAGEIGATPPMDHRIDESGISLPRCVTESREGVPCK
Ga0315912_1084046123300032157SoilGTDSVAEQIEYGFAGDVGTLPPIDHRLQGVGISVPKCFNESREGEGC
Ga0307470_1132498313300032174Hardwood Forest SoilLAAQDTDSVQKQIAYGFVGDVGTTPPMDHRIDETGISVPKCMTDSREGQACQ
Ga0307471_10344894523300032180Hardwood Forest SoilDTDSVQKQIEYGFAGDVGTTPPMDHRIDETGISVPTCFNDSREGNACR
Ga0307471_10347196013300032180Hardwood Forest SoilALALMHAQTTDWVAKKIDSGFAGAVGTTPPMDHRIDETGISTPDCFEESREGAACK
Ga0315271_1160801513300032256SedimentIEYGFAGDVGTLPPMDHRLQGVGISVPACFNNSREGEAC
Ga0335084_1212215513300033004SoilTDSVAQQIEYGFAGDVGVLPPIDHRLQGVGISVPKCFNESREGEGC
Ga0335084_1216441023300033004SoilQIEFGFAGDVGVLPPMDHRLQGVGISVPKCFNESREGEAC
Ga0335077_1031331313300033158SoilAQQVEYGFAGDVGVLPPIDHRLLGVGISVPKCFNESREGENC
Ga0214471_1028213613300033417SoilFAGDVGTTPPMDHRLDETGISVPHCLNESREGVPCK
Ga0214471_1102179613300033417SoilSVAEQVEYGFAGDVGTTPPMDHRLDETGISVPECLNESREGVPCK
Ga0364940_0258788_8_1423300034164SedimentVAKQIKDGFAGDVGTTPPMDHRIDDTGISVPACFEESREGQGKC


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.