NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004634

3300004634: High solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-1D-10D



Overview

Basic Information
IMG/M Taxon OID3300004634 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110114 | Gp0088361 | Ga0066906
Sample NameHigh solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-1D-10D
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3103212823
Sequencing Scaffolds129
Novel Protein Genes140
Associated Families18

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus89
All Organisms → Viruses → Predicted Viral3
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae3
Not Available13
All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus suber2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus lobata4
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Thermoclostridium → Thermoclostridium stercorarium1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus robur4
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameIonic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa
TypeEngineered
TaxonomyEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationJoint BioEnergy Institute, California, USA
CoordinatesLat. (o)38.5402Long. (o)-121.75Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000459Metagenome / Metatranscriptome1109Y
F001938Metagenome / Metatranscriptome614Y
F002238Metagenome / Metatranscriptome579Y
F006329Metagenome / Metatranscriptome376Y
F010514Metagenome302Y
F025338Metagenome / Metatranscriptome202Y
F026621Metagenome / Metatranscriptome197Y
F031319Metagenome182Y
F031884Metagenome / Metatranscriptome181Y
F038199Metagenome166Y
F039163Metagenome / Metatranscriptome164Y
F042357Metagenome / Metatranscriptome158Y
F081964Metagenome113Y
F087072Metagenome / Metatranscriptome110Y
F088752Metagenome / Metatranscriptome109N
F091897Metagenome / Metatranscriptome107Y
F099151Metagenome / Metatranscriptome103N
F101010Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066906_10004957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales6751Open in IMG/M
Ga0066906_10008691All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus4985Open in IMG/M
Ga0066906_10011526All Organisms → Viruses → Predicted Viral4314Open in IMG/M
Ga0066906_10015208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera3775Open in IMG/M
Ga0066906_10020931All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus3262Open in IMG/M
Ga0066906_10023153All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus3122Open in IMG/M
Ga0066906_10024456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus3047Open in IMG/M
Ga0066906_10030537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus2766Open in IMG/M
Ga0066906_10043184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera2391Open in IMG/M
Ga0066906_10052398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales2206Open in IMG/M
Ga0066906_10053725All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae2183Open in IMG/M
Ga0066906_10056123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus2144Open in IMG/M
Ga0066906_10064000Not Available2033Open in IMG/M
Ga0066906_10064694All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium2023Open in IMG/M
Ga0066906_10074509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus suber1907Open in IMG/M
Ga0066906_10079896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1851Open in IMG/M
Ga0066906_10094330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae1725Open in IMG/M
Ga0066906_10100444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae1680Open in IMG/M
Ga0066906_10100907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1677Open in IMG/M
Ga0066906_10109330All Organisms → Viruses → Predicted Viral1621Open in IMG/M
Ga0066906_10114864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1587Open in IMG/M
Ga0066906_10118835Not Available1564Open in IMG/M
Ga0066906_10118973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1563Open in IMG/M
Ga0066906_10125267All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1530Open in IMG/M
Ga0066906_10129974Not Available1506Open in IMG/M
Ga0066906_10130207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1505Open in IMG/M
Ga0066906_10133354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1489Open in IMG/M
Ga0066906_10135822All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1477Open in IMG/M
Ga0066906_10136415Not Available1474Open in IMG/M
Ga0066906_10142780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1446Open in IMG/M
Ga0066906_10146454All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1430Open in IMG/M
Ga0066906_10148864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1420Open in IMG/M
Ga0066906_10161680All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1369Open in IMG/M
Ga0066906_10163912All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1361Open in IMG/M
Ga0066906_10174786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1323Open in IMG/M
Ga0066906_10177082All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus lobata1316Open in IMG/M
Ga0066906_10177596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1314Open in IMG/M
Ga0066906_10201689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1243Open in IMG/M
Ga0066906_10201964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1242Open in IMG/M
Ga0066906_10202190All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1241Open in IMG/M
Ga0066906_10202652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1240Open in IMG/M
Ga0066906_10202812Not Available1240Open in IMG/M
Ga0066906_10209966All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1221Open in IMG/M
Ga0066906_10236630All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1158Open in IMG/M
Ga0066906_10253188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1123Open in IMG/M
Ga0066906_10273010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1086Open in IMG/M
Ga0066906_10298847All Organisms → Viruses → Predicted Viral1042Open in IMG/M
Ga0066906_10301876All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1037Open in IMG/M
Ga0066906_10324242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus1003Open in IMG/M
Ga0066906_10333784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus990Open in IMG/M
Ga0066906_10344122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus lobata976Open in IMG/M
Ga0066906_10344356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus976Open in IMG/M
Ga0066906_10351340All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus suber967Open in IMG/M
Ga0066906_10355095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus962Open in IMG/M
Ga0066906_10359752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus956Open in IMG/M
Ga0066906_10366024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Thermoclostridium → Thermoclostridium stercorarium948Open in IMG/M
Ga0066906_10375533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus937Open in IMG/M
Ga0066906_10392777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus918Open in IMG/M
Ga0066906_10398425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus912Open in IMG/M
Ga0066906_10419785All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus890Open in IMG/M
Ga0066906_10439598All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus871Open in IMG/M
Ga0066906_10440721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus870Open in IMG/M
Ga0066906_10455520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus856Open in IMG/M
Ga0066906_10459984All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus852Open in IMG/M
Ga0066906_10470209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus843Open in IMG/M
Ga0066906_10477756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus837Open in IMG/M
Ga0066906_10482482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus833Open in IMG/M
Ga0066906_10502574All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus817Open in IMG/M
Ga0066906_10513086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus809Open in IMG/M
Ga0066906_10518351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus805Open in IMG/M
Ga0066906_10532537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus795Open in IMG/M
Ga0066906_10552867All Organisms → cellular organisms → Bacteria → Proteobacteria780Open in IMG/M
Ga0066906_10568854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus770Open in IMG/M
Ga0066906_10569830All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus robur769Open in IMG/M
Ga0066906_10574416All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus766Open in IMG/M
Ga0066906_10595718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus753Open in IMG/M
Ga0066906_10598244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus751Open in IMG/M
Ga0066906_10641734All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus726Open in IMG/M
Ga0066906_10655917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae718Open in IMG/M
Ga0066906_10663354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus714Open in IMG/M
Ga0066906_10670233All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus711Open in IMG/M
Ga0066906_10675776Not Available708Open in IMG/M
Ga0066906_10678894All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus706Open in IMG/M
Ga0066906_10688577Not Available701Open in IMG/M
Ga0066906_10695291Not Available698Open in IMG/M
Ga0066906_10703837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales694Open in IMG/M
Ga0066906_10704853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus693Open in IMG/M
Ga0066906_10705015All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus693Open in IMG/M
Ga0066906_10748819All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus673Open in IMG/M
Ga0066906_10759058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus668Open in IMG/M
Ga0066906_10762203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus667Open in IMG/M
Ga0066906_10783143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus658Open in IMG/M
Ga0066906_10809892Not Available647Open in IMG/M
Ga0066906_10831032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus639Open in IMG/M
Ga0066906_10836469Not Available637Open in IMG/M
Ga0066906_10877576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus622Open in IMG/M
Ga0066906_10903587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus robur613Open in IMG/M
Ga0066906_10920840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus607Open in IMG/M
Ga0066906_10930528All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus604Open in IMG/M
Ga0066906_10936779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus602Open in IMG/M
Ga0066906_10949084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus598Open in IMG/M
Ga0066906_10965013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata593Open in IMG/M
Ga0066906_10974378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus590Open in IMG/M
Ga0066906_10987754Not Available586Open in IMG/M
Ga0066906_10995262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus584Open in IMG/M
Ga0066906_11003245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus581Open in IMG/M
Ga0066906_11004351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus581Open in IMG/M
Ga0066906_11025476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus575Open in IMG/M
Ga0066906_11044136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus570Open in IMG/M
Ga0066906_11055013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus robur567Open in IMG/M
Ga0066906_11081505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus560Open in IMG/M
Ga0066906_11091436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus557Open in IMG/M
Ga0066906_11119188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus550Open in IMG/M
Ga0066906_11121996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus robur549Open in IMG/M
Ga0066906_11127212All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus548Open in IMG/M
Ga0066906_11127407All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus548Open in IMG/M
Ga0066906_11130140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus547Open in IMG/M
Ga0066906_11145914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus543Open in IMG/M
Ga0066906_11145925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus543Open in IMG/M
Ga0066906_11163500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus lobata539Open in IMG/M
Ga0066906_11176831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus536Open in IMG/M
Ga0066906_11177548All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max536Open in IMG/M
Ga0066906_11253533Not Available519Open in IMG/M
Ga0066906_11256232All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus518Open in IMG/M
Ga0066906_11291615All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus511Open in IMG/M
Ga0066906_11304490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus lobata508Open in IMG/M
Ga0066906_11309272Not Available507Open in IMG/M
Ga0066906_11335915All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus502Open in IMG/M
Ga0066906_11341659All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066906_10004957Ga0066906_100049572F101010MFRIENAYATVWSVEDKGNYVKGRISTSEKNKEGKYVNSNWFVTFVGKAKEPALALSTKDRIKIISGKISNTTTGEGEDKKSYLNVVIFDFENMSNSQTDNQMDDLPF*
Ga0066906_10008691Ga0066906_100086919F031319LDFLLSMVMREGETLKMYLDRYWEMFNKINLNFDDVAIRTFKVGLLAEQDLRKFLTRKLAKSIRQLMDRIDEYKRVEEDQ*
Ga0066906_10011526Ga0066906_1001152613F087072MKSKVFTKRMFSLELSEEELSIIAGALYCANSEDIKCFVDKYKYPCAGYNFDEIAELKDRLSEEINKIIESK*
Ga0066906_10015208Ga0066906_100152087F031319MFNEIDGDFDDVAFSTFKLSLPTEHGLRKSLTGKSVTSIHQLMDWIDKYKRVEEDQ*
Ga0066906_10020931Ga0066906_100209311F031319MVMKEGGTLKTYSDRYWVMFNDKDGDFEGLAIRTFKVGLPTNHDLRKSLTMKPAWSICQLMDRIDEHKRV*
Ga0066906_10023153Ga0066906_100231534F031319MFNKIDGDFDDVVISNFKVGLLAEHGLRKSLTSKPVTNMHQLMDRIDKYKKVEENQ*
Ga0066906_10024456Ga0066906_100244564F031319MFNEIDGDFDDVVISTFKVGFPTEHDLRKSLTGKLVTSVRQLMDRVDKYKRVEEDMAEVRKD*
Ga0066906_10030537Ga0066906_100305371F031319MFNEIDGDFDDVTISTFKVGLPTEHGLRKSLTGKPVTSVYQLMNRIDKNKRVEEDQQ*
Ga0066906_10043184Ga0066906_100431846F031319MYNEMDGNFEDVTISTFKSGLPTEHGLRKSLTGKPITNLRQLMDRIDKYKRVEEDQQLGKGKDKVIP*
Ga0066906_10046786Ga0066906_100467863F031319LSLSIRERETLKTYSNRYYEMFNEIDGDFDDVAIRTFKVGLLAEHGLRKSLTGKAATSVWQLMDWINKYKRVEKDQ*
Ga0066906_10048045Ga0066906_100480452F031319MCSKVPRPLDSLLSMSMRERETLKTYSDKYWEMFNEIDGDFDDVALRNFKVGLPAEHDLRKSLTKKLVRSMHRLMDCIDEYKRVEED*
Ga0066906_10052398Ga0066906_100523983F031319MFNKIDGDFDDMAIRTFKVDLPAEHGLRKSLTGKPAGTMHQLMDRIDKYKRVKEDQQQGKRKGKVIP*
Ga0066906_10053725Ga0066906_100537254F031319MFNEIDGDFDDVAISTFKVSLPTKHDLRKSLTGKPVTSVIQLMDQIDKYKRVEEDQQ*
Ga0066906_10056123Ga0066906_100561232F031319MFNEINGDFDNVAINTFKLGLPVEHDLKKSLTGKSVTSVRQPMDRIDNYKRVEED*
Ga0066906_10064000Ga0066906_100640001F031319MAMREGETLKMYFDRYWEMFNKIDENFDNVAIRTFKVCLLAEHELRKSLTRKSVRSVRRLMDCIDKYKWVK*
Ga0066906_10064694Ga0066906_100646943F031884ADRERLAAVNKRLQAELDENARLRKELSEARAKLDAIANIEKSLSERKPNTEGRTQ*
Ga0066906_10072100Ga0066906_100721002F031319MTMQEGETLKTYSNRYWEMFNEIDGDFDNVAIRTFKLSLPVEHDLRKSLTKKLVRSVRRLMDHIDEYK*
Ga0066906_10074509Ga0066906_100745093F031319MFNEIDGNFADVTIRTFKVGLSAEHDLRKSLTRKPVRSVRQLIDYIDEYR*
Ga0066906_10079896Ga0066906_100798962F031319MFNKIYGDFDDVTISTFKFGLLAEQGLRKCLTGKPITSVRQLIDWINKYKRVEEDQQQARERARLSLKR*
Ga0066906_10094330Ga0066906_100943302F031319MYNEKDDNFDDVATNTFKSSLPTKHGLRKSLIRKPVTSLCQLMDWIDKYKRVEEDQ*
Ga0066906_10100444Ga0066906_101004441F031319LDSLLSLSMQEGEILKAYLDRYWETYNEIDGEFDDVAISTFKSGLPTEHGLRKSLIGKPVTSLRQLMDQIDKYKRVKED*
Ga0066906_10100907Ga0066906_101009073F031319MSMREGETLKAYSNRYWEMFNEIDSDFDDVAIRTFKVGLPTEHGLRKSLTRKPATSVRKLMERIDKCKRVEEDKQQGKGKGKAISQERGDFRLD*
Ga0066906_10109330Ga0066906_101093305F088752MEGLQNVYSQIINILKENNVLINITPSRPYLIKKDDEERINAEAEDLFKKCKIEEYNSKMKEKEAYKLYFDEAYKYTNFYEE*
Ga0066906_10114864Ga0066906_101148641F031319MREWEILKTYLDMYWEMYNEIEGNFEDVAFSTFKNGLPAEHGLRKSLTGKQVTSLRQLMDRIDKFKMVEEDQQLDKGKAKVIP*
Ga0066906_10118835Ga0066906_101188355F031319FDDVAISTFKVGFPAEHGLRKSLIDKPITSVIQFVDWIDKYKRVEEDQ*
Ga0066906_10118973Ga0066906_101189731F031319LKTYSDRYWEMFNKINGNFDDMAISTFKVGLPVEHDLRKSLTRKLIRSVRQLIDRIDEYKRVVKDQQ*
Ga0066906_10120022Ga0066906_101200222F031319MKLTDSDFEDVAISTFKVGLPIEHSLRKSLTGKTVTSVCQLMDRSDKYKRVEENQQQGKGKDKVISQERRDFKSD*
Ga0066906_10125267Ga0066906_101252672F031319MFNEIDGDFDDVAINTFKVSLPAEHGLRKSLTGKPVISLRQLMDRIDKYKRAKED*
Ga0066906_10129974Ga0066906_101299741F091897MIGSSIPTFLNMQYRCCECGRNLGDKYSRLKGKKQPDVNIIKGKLYCNKCAD
Ga0066906_10130207Ga0066906_101302072F031319MFNEIDDDFEDIAISTFKLSLPAKHDLRKSLTGKPITSIRQLMDRIDKYKRVEED*
Ga0066906_10133354Ga0066906_101333543F031319MYNEMDGNFEDVTISIFKSGLPTEHGLRKSLTGKPVTNLRQLMDRIDKYKRVKED*
Ga0066906_10135822Ga0066906_101358222F031319MYWEMYNKIEGNYDDVAISIFKSGLPTEHGLRKSLIGKLVTSLRQLMNRINKYKRVEED*
Ga0066906_10136415Ga0066906_101364153F038199MQYTQAEFLQLIQQYNSTDRKIIKANLKHIMDIYGIKPADIIALGYSSRNVYAWTNRSTSNIPLFEQALNIAVKFNFSITEFIK*
Ga0066906_10142780Ga0066906_101427802F031319MFNEIDGDFDDVGIRTLKVGLPTEHGLRKSLTGKLAGNVRQLMDQIDKYKWVNEDQQ*
Ga0066906_10146454Ga0066906_101464542F031319MFNEIDGDFDDVVISNFKVGHLVEHGLRKSLKGKPVINMRQLMDRIDKYKRVEEDQ*
Ga0066906_10148864Ga0066906_101488641F031319MKTYSDRYWEMFNEIDGDFDDVAIRTFKVSLPTEHGLRNSLTGKPATSVLKLMEHIDKYKRVEKDQQQGKGKGKAIP*
Ga0066906_10161680Ga0066906_101616803F031319LDSLLSLSMREGETLKAYSDRYWEMYNEIEGNFDDFPIRTFKSGLPTKHGLRNSLTGKPVTSLHQLMDRIDKYKRVEEDQ*
Ga0066906_10163912Ga0066906_101639125F031319MREGETLKAYSDRYWEMYNEIEGDYDDVAINTFKRGLPTKHGLRKSLTRKSITSLRQFMDRIDKYKRVEEDQ
Ga0066906_10174786Ga0066906_101747863F031319MYNEMDENFDDVTISTFKSSLPTKQGLRKSLTGKPVTSIRQLMDRIDKYKRVEEA*
Ga0066906_10177082Ga0066906_101770821F031319MSMRDGETLKTYSDKYWEMFNEIEGEHDDVAIRTFKAGFPAEHDLRKSPTSKPVTSIHQLMDRIDKYKRVEKDQLQGKGKAKVIPQERRDF
Ga0066906_10177596Ga0066906_101775961F031319MFNEIDGDFEDVAVITFKLGLPVEHGLKKSLTRKPVTSICQLMDQIDKYKRVEEDH*
Ga0066906_10201689Ga0066906_102016892F031319MFNEIDSDFDDVAISTFKVGLLVKHNLRKSLTRKPVTSMHQLMDRIDKYKRVEED*
Ga0066906_10201964Ga0066906_102019642F031319MQEGETLKAYSDRYWEMYNEIEGNYDDVAISTFKSSLPTEHCLRKSLAGKPVTTYRLMDRIDKYKRVEKDQQLGKGKAKVVPQERRDFRSD*
Ga0066906_10202190Ga0066906_102021903F031319MFNEIDGDFDNVAISTFKVGLPTEHGLRKSLMGRLVTSVCQLMDWIDKYQRVEEDEQ*
Ga0066906_10202652Ga0066906_102026522F031319MAIREGESLKMYSDRYWEIFNEIGSDFDNVSIRTFKVGLPAEHGLRKSLIRKLATSVRQLMDRIDKYKRV
Ga0066906_10202812Ga0066906_102028121F031319MFNEIDDDFDDVAIRTFKVGLLVEHGLRKSLTRKPANNVRQFMDRIDKYKWVEKD*
Ga0066906_10209966Ga0066906_102099663F031319MFNEIEGDYDDVAISTFKAGLPIEHNLKKSLTGKPVTSVRQLMDWIDKYIRVEEDQLQGKEKAKVIP*
Ga0066906_10236630Ga0066906_102366304F031319MREGETLKAYSDRYWEMYNEIEGNYDDITISTFKRGLPTKHGLRKSLTGKPVNNVRQLMDRIDKYK*
Ga0066906_10253188Ga0066906_102531882F031319DRYWEMFNEIDGDFDDVAINTFKVGLPTEHSLRKSLINKPITNVRQLMNRIDKYKRFKED
Ga0066906_10273010Ga0066906_102730101F031319LDSLLSLSIQEGETLKDYSDRYWEMDNEIEGNYDDVAIITFKSGLPTEHGLRKSLTGKPVTNLRQLMDRIDKYKRVEENQ*
Ga0066906_10298847Ga0066906_102988471F091897MIGSSINSFPNMQYQCCKCGKDLGDKYSRLKQKQPDVNIIKGKLYCNKCAD
Ga0066906_10301876Ga0066906_103018762F031319MFNEIDGDFDDVAIRTFKIGLPTEHGLRKSLIGKPVTSVRYLMDRIYKYKRVEEDQ*
Ga0066906_10324242Ga0066906_103242421F031319MYNEIEGNFNDVTISTFKSGLPTEHGLRKSLMGKPVTSLRQLIDRIDKYKRVEED*
Ga0066906_10333784Ga0066906_103337843F031319SCFIMSSKVPRPLDSLLSLSMQEGETLKAYSNRYWEMYNEIEGNYKVAINTFKRGPPIEHSLRKSLTRKLVTSLHQLMNRIDKYKRVEEDQ*
Ga0066906_10339025Ga0066906_103390251F000459VHSGRIKLAENVKRGRGRPHLTWEESVKRDLKVWDIAKELAMDRGAWKLAIHVPEP*
Ga0066906_10344122Ga0066906_103441221F031319KTYSDRYWEMFNEIDGDFDDVAISSFKVGLLAKHGLRKSLTGKPVTSVRQLMDRIDKYKRVEEDQQQRKGKAKVIL*
Ga0066906_10344356Ga0066906_103443562F031319TLKAYSDRYWEMYNEMDENHDDVAISTFKSGLPIEHSLRKSLTGKPIISVRQLMDRIDKYKKVEKDQL*
Ga0066906_10351340Ga0066906_103513402F031319MTIREGETFKTYSDKYWGMYNEIDGDFEDVAVKTFKVRLLTEHELRKSLTMKSALNMHQLMDRIDKYKRVEEDQIQGKDKAKMFPKKRDP*
Ga0066906_10355095Ga0066906_103550951F031319MFNEIDGDFDDVTISTFKLCLPSEHGLRKSLIGKPVTSVRQFMDWIDKYKRVEEDQQQGKGKGKVIP*
Ga0066906_10359752Ga0066906_103597521F031319MAMREGKTLKTYSDRYWETYNEIDGNFEDVAVRTFKVGLPAKHKLKKSLMMKSVLNMCQLINRIDKYKRVEGD*
Ga0066906_10366024Ga0066906_103660242F001938MIEKIYKNKYMATCDNCGTGQECDNWADAIDFMNEEGWKKKLADGEWKHYCPECQESEVEQDA*
Ga0066906_10375533Ga0066906_103755332F031319MREGETLKAYSDKYWEKYNEIEGHYNDVAISTFKRDLPTKHGLRKSLPRKPVTSVHQLMDRIDKYKRVKEDQQTGKGKAKVVPQGGGTSG*
Ga0066906_10392777Ga0066906_103927772F031319MHEGETLKAYSNRYWEMYNEMDDNYDDVAISTFKSGLPTEHGLRKSLTSKPVTNVHQLMD*IDKYKRVEEDQLQGKGKEKI
Ga0066906_10398425Ga0066906_103984251F031319MYSDRYWEMFNEIDSDFDDVAINTFKVGLSTKHSLRKSLTGKPITSVRQLVEQIDKYKRVEEDQQLGKGKFKVIP*
Ga0066906_10419785Ga0066906_104197851F031319DSLLSLSMQEGETLKAYLDKYWEMYNEIKGNYDDVAINTFKSGLPTEHGLRKSQIGKPVTNLRQLMD*
Ga0066906_10439598Ga0066906_104395983F031319LLSLSMHDRETLKAYLDRYWETYNEMEDNFYDVAIITFKNILPADHSLRKSLTDKHATSMRQLMDRIDKYKRVEED*
Ga0066906_10440721Ga0066906_104407212F031319SLLSLSIREGETLKTYSNKYWEMFNVIDGDFEDVAISTFKLGQPAEHGLRKSLTGKPVTSICQFMDRIDNYKRVEEDQQ*
Ga0066906_10452991Ga0066906_104529911F025338MSVSGADRTRKLLTVGVGTVLIVVMGAVLIAGFRLATQMNANVAALQTASMLQTYPAALAQHLTSLRDRLEARAYAGQALADLRTTVESFDRDLKRLASGPAEGPMQIDQAMMLWRQYAPVLEPVLAFNGQPYIDTDEAGSVLSKEGLEHYADVK
Ga0066906_10455520Ga0066906_104555203F031319MHEGETLKSYADRYWEMYNEMDGNHDDVTISTFKSGLPTKHCLRKSLTCKPVTNVRQLMDRINKYKRVEED
Ga0066906_10459984Ga0066906_104599841F031319EGKTLKMYSDRYCEIFNEIDGDFDDVTIRTFKVGLPVKFDLRKSLTRKPVRSVCRLMDRIDEYKRVKEDQQ*
Ga0066906_10470209Ga0066906_104702091F031319ETLKTYSDRYWEMFNEIDGDFDEVAISTFKAGLPAEHSLRKSLTGKPVTSVRQLMDWIDKYKRVEEDQQ*
Ga0066906_10477756Ga0066906_104777561F031319MFNEIDGDFDDVAIRTFKVGLPAEHGLRKSLTGKPSGSVRQLMDRIDKYKRVGVD*
Ga0066906_10482482Ga0066906_104824822F031319MFNEIDGDFDDLTISTFKVGLPAEHSLRKSLTGKPVISVCQLMDRIDKYKRVEEDQQLGKGKAKVIP*
Ga0066906_10502574Ga0066906_105025742F031319MFNEIDRDYDDVAISTFKAGLSAEHDLRKSLTGKPVINVRQLMDWIDKYRRVEKDQIQGK
Ga0066906_10513086Ga0066906_105130862F031319MYNRIESNFDDVAISTFKNGLPTKHGLRKSLTGKPVTNLHQLMDWINKYKRVEEDQ*
Ga0066906_10518351Ga0066906_105183512F031319MYNEIEGNYDDVAISTFKRGLSTEHGLRKSLTRKPATSMRQLMDRIDKYKRVEEASRWVREK*
Ga0066906_10532537Ga0066906_105325372F031319MFNEIDGDFEDVAISTFKLGLPVEHGLRKSLIGKPVTSVRQLMDWIDKYKKVEEDQ*
Ga0066906_10552867Ga0066906_105528671F026621MILRQLQDLIGGIYDVSVAHDVYDFLVTDRGHLPAAARSNPSDEALIVAQDS
Ga0066906_10564353Ga0066906_105643531F031319MAMQEGEILKTYLDRYWEMFNKIDRNFNDVAIREFKAGLLARHDLRKSLTKKPAQSVHQLMD*
Ga0066906_10568854Ga0066906_105688541F031319MFNEIKGDFKDVAINTFKLGLLAEHGLRKSLTGKPVTSICQLMDRIDKYKRVEEEQLQDKGKGKIIP*
Ga0066906_10569830Ga0066906_105698302F031319MHDGETLKVYSDRYWETYNEMKDNFDDIAIITFKNSLLADHSLRKSLTGKPTTDMHQLMDRIDKYKRVEEDQL*
Ga0066906_10574416Ga0066906_105744161F031319LKTYSNRYWEIFNEIDGDFDDVVIGTFKLGLPAVHGLRKSLIGKPVTSIRQLMDQID
Ga0066906_10595718Ga0066906_105957181F031319MHDGETLKAYSDRYWETFNEMGNNFDDVAISTFKNSLLAEHSLRKPLTDKPATSMRQLMDRIDKYKRVEED*
Ga0066906_10598244Ga0066906_105982441F031319MRERETLKMYSDRYWEMFNEIDKDFDYVAIRTFKVGLLAEHDLRKPLTKKPVRSVCWLMDPI
Ga0066906_10641734Ga0066906_106417342F031319LDSLLSLSMQKGETLKMYLDKYWEMYNEIEGDFDDVTISTFKVSLLIEHSLRKSLTGKPVTSMPQLMDRIDKYKRVEEDQ*
Ga0066906_10655917Ga0066906_106559171F002238MTVTTQDDSSEFQRGWDAALQAVRFWHEAQAKQAMVQSTRTRFPKNLEREAEVHRRAAERILTLSPDDV*
Ga0066906_10663354Ga0066906_106633541F031319MQQGSSTLDSLLSMAMREGKTLKTYPDRYWEMFNEIDGDFNDVAIRTFKVGLPTEYGLRKSLTGKPTTNVCQLIDRINKYKRVEED*
Ga0066906_10670233Ga0066906_106702331F031319MYDEETLKAYSDRYWETYNEIEDNFDDVAIITFKNSLPTDHGLQKSMTGKPATSMRQLMDRIDKYK*
Ga0066906_10675776Ga0066906_106757762F091897MGIGSCQSFFPNKNYICENCGRNLRDKYSRLKGKKQPNVNIINGKYYCDRCFDEQLSK*
Ga0066906_10678894Ga0066906_106788942F031319MFNEIEGDYDDMTISTFKASLPVEHDLRKSLTGKPVTSVRQLMDRIDKYRRVEEDQL
Ga0066906_10688577Ga0066906_106885772F031319MGKGETLKTYSDRYYEVFNEIDEDFEDVAIRTFKVSLPTKHDLRKSLTVKPTRSMRQLMDRIDEYKQVEKDQ
Ga0066906_10693014Ga0066906_106930141F031319LKTYSDRYWEMFNEIDGDFNDVAIRTFKVGLSAEHGLRKSLTGKPTTSVCQFMDRIDKYKRVEEDQQQGKGKVKVVPQERRDFRSNQYNNNRP*
Ga0066906_10695291Ga0066906_106952911F031319RELTQAFGSRFITCSRVLQPLDSLLSMSMREGETLKTYSDRYWEMFNEIDDVAIRTFKVGLPTDHGWRKSLTRKPAISVRKLIEWINKYKRVERD*
Ga0066906_10703837Ga0066906_107038371F031319LKTYSDRYWEMFNEKDGDFDDVAIRTFKAGLPTEHGLRKSLTEKPGTSVRQLINRIDKYKRVEEN*
Ga0066906_10704853Ga0066906_107048532F031319MYYEIEGNFDDVAISTFKSDLHSLRKSLIGKPVTSLCQLMDRIDKYKRVEKDQQLGKGKAKIVP*
Ga0066906_10705015Ga0066906_107050152F031319MHEGETLKAYSDRYWEMYNKMDGNYDDVAISTFKSGLPTKHCLRKSLTGKPVTSVHQLMEQIDKYKMVEEEQLQGK*
Ga0066906_10748819Ga0066906_107488191F031319MYNEIEGNYDDVAIITFKSGLPIKHGLRKSLTEKPVTNLRQLIGRIYKYKRVEEDQHLGKGKAKVVP*
Ga0066906_10759058Ga0066906_107590581F031319YSDRYWEMFNEIDGDFDDIAIRTFKVGLPTEHGLRKSLTGKPVTSVRQLMDRIDKYKRVEEDQ*
Ga0066906_10762203Ga0066906_107622031F031319SLSMREGETLKTYSDRYWETFNEINGDFDDVAISTFKLGLPTEHGLRKSLTGKPVTSIRHLMDRIDKYKRVEKDQQQDKGKGKVIP*
Ga0066906_10783143Ga0066906_107831432F031319MSMREDETLKAYSDRNWEMFYEIEGEYSDVAISTFKASLPVEHDLRKSLTGKPVTSVRQLMDRINKYRRVEED*
Ga0066906_10809892Ga0066906_108098921F099151MKFREEIYKENGEIIKKYYIDDKEVTQDVYFNLTDELYENTKLKQDDHNEEICNCEECQYFLELINEIRQSSDSEALAILKDEIEFRVQEAYIEGQHVLANELGNSLLKHAVKLEDELDNLYENGSLDEYNEDS*
Ga0066906_10831032Ga0066906_108310322F031319SMHDGETLKAYSDRYWEMYNEMDDNFDDVPISTFKNSLLAQHDLRKSLTGKPATSVRQLMDQIDKYKRVKEE*
Ga0066906_10836469Ga0066906_108364692F031319MFNQIDGDFDDVAIRTFKVGLPTQHGLRKSLTGKPATNVRQLMDWIDKYKWVEEDQQ*
Ga0066906_10877576Ga0066906_108775761F031319LKTYLDRYWEMYNEIYGNFENVAISTFKSGLPTEHGLRKFLTGKPVTSQNQLMDRIY*
Ga0066906_10903587Ga0066906_109035871F031319MHNGETLKAYSDRYWETYNEIDDNFDDVTIITFKISLPAEHDLRKSLTGKPATSMCQLMDRIDKYKRVEED*
Ga0066906_10920840Ga0066906_109208401F031319LKTYSDKYWEMFNEIDGDFDHVAISTFKVSLPTEHGLRKSLMGKPVTSVCQLINRIDKYKRIEKDQ*
Ga0066906_10930528Ga0066906_109305282F031319MYNEIDGNFDDVAINTFKVGLLTKHGLRKSLTGKPVTSMHQLMGRIDKYNRVEED*
Ga0066906_10936779Ga0066906_109367792F031319SRVPRPLASLLSLSMREGETLKTYSDRYWEIFNEIDGDFEDVAISTFKLDLPTEHGLRKSLTGKPVTSIHQLMDHIDKYRRVEENQ*
Ga0066906_10949084Ga0066906_109490841F031319MREGETLKAYSDRYWEMYNELDENHDNVAIITFKSGLPTEHDLRKSLTGKPVANVHQLMDRIDK*
Ga0066906_10965013Ga0066906_109650131F039163ERFIDHIGSEKTPICTVQQWGILVNGLTAEPAIWRNVIV*
Ga0066906_10974378Ga0066906_109743782F031319LDSLLSLSMREGETLKAYSDRYWEMYNEIEGNFDDVAINTFKSGLLAEHGLRKSLTKKPITSLRQLMDRIDKYKRVEED
Ga0066906_10987754Ga0066906_109877541F006329MKLELYIADVVHDHKIQMDDHNMKMKKNEEEKIAMRLKMRKIRKYAINKEAWYHYVVGSMVTLVAILIAFVVAFKCIN*
Ga0066906_10995262Ga0066906_109952621F031319CSRVPRPLDSLLSMSIREGETLKTYLDKYWEMFNEIDGDFDDVAIRTFKVGLPTEHDLRKSLTKMPVKSVRRLIDHIDEYKRVKEDQQ*
Ga0066906_11003245Ga0066906_110032451F031319MFNEIDGDFDDVTISTFKLCLPVEHGLRKSLIGKPVTSVRHLMDWIDKYKRVEKD*
Ga0066906_11004351Ga0066906_110043511F031319MFNEIDGDFDDVVISIFKVGRPAEHGLRKSLKGKPVTNVRQLMDRIDKYKRVEEDQ*
Ga0066906_11025476Ga0066906_110254761F031319MSMREGETLKTNSDRYWEMFNEIEGEHDNVAISTSKAGLPVEHDLRKSLTGKPVTSVHQLMDRIDKYRRVEEDQL
Ga0066906_11044136Ga0066906_110441361F031319MYNEIEGDFENVTISTFKSGLPAEHGLRKSLTGKPVTSLCQLMDRIDKYKRVEEDQQLSKGKSKVIP*
Ga0066906_11055013Ga0066906_110550132F031319CSRAPRPLASLLSLSMREEKTLKTYSDRYWEMFNEIGGDFKDVAISTFKLGLPAEHDLRKSLTGKPVTSIRQLMDWIDKYKRVEEDQLQDKGKGKVIL*
Ga0066906_11077560Ga0066906_110775601F031319YWKMFNEIDSDFDDVAIKTFKVSLPAEHGLRKSLIGKPATSVRQLIDRIDKYKRVEEDQQQGKGKAKVVP*
Ga0066906_11081505Ga0066906_110815052F031319LDSLLSLFMRDGEILKAYSDRYWEMYNEIKGNYDDVAISTFKRGMPTEHDLRKSLTGKPVTSLR*
Ga0066906_11091436Ga0066906_110914361F031319MFNEIKGEHDDMAISTFKASLPAEHDLRKSLTSKPVTSVHQLIDRIDKYRRV
Ga0066906_11119188Ga0066906_111191881F031319DSLLSLSMQEGETLKAYLDRYWKMYNEIEGKYDDVAISTFKSSLPTEHGLRKSLTGKPVTSLCQLMDRIEKYKRVKKDQ*
Ga0066906_11121996Ga0066906_111219961F031319MREGEILKTYLDRYWEMFNEIDDDFDDVAISIKLGLPAKHGLRKSLTGKPVTSVRQLMDQIDKYKKVEEDQ*
Ga0066906_11122201Ga0066906_111222011F031319MREKETLKMYSDRYWEMFNEIDGDFDDIAIRTFKVGLPAEHGLRKSLTRKPINSVCQLMGRIDKYKRVKDDQQQGKGKAKVIHQEKRDFKRDHYN
Ga0066906_11127212Ga0066906_111272122F031319MYNEIEGNHDDVAINTFKSGLPTKHGLRKSLTGKPVTSLRKLIDRIDKFKRVEEDQQLGK
Ga0066906_11127407Ga0066906_111274071F031319MREGETLKAYLDRYWEMYNEIQGNYNDVVINTFKRGLPTKYGLRKSLTGKLVTSVHQLMDRIDKYKRVEEDQQTGKGKAK
Ga0066906_11130140Ga0066906_111301401F031319FDDVAIRTFKVGLPTEHGLRKSLTGKPTTSVRQLMDRIDKYKRVEED*
Ga0066906_11145914Ga0066906_111459141F031319MFNEIDSDFDDVAISTFKLSLPAEYDIRKSLTGKPVTSIHQLMDRIDKYKRVEED*
Ga0066906_11145925Ga0066906_111459252F031319MYNEIEGNYDGITISTFKRGLSKEHSLRKSLIGKSVTSVRQLMDRIDKYKRVEKDQQTGKGKEKVVL*
Ga0066906_11163500Ga0066906_111635001F031319MYNEIDGDFDDVAISIFKSGLLIKHGLRKSLTGKPVTSLRQLMDQIDKYKMVEED*
Ga0066906_11176831Ga0066906_111768311F031319MYNEIEGNYDDVAISTFKRGLPIEHGLRKSLTEKPVTNVRQLIDRIDKYKKVEEVQ*
Ga0066906_11177548Ga0066906_111775481F042357MEMKPKGTSLGRNPLSDAPHRNPGVVSNGQGPGRHPLGGAPYLDLDTVISEQGSGRRILSGALHRRPGVVKNEQGSPHLTRRVRRVRKLAEPRRIRLGSWNVGSLTGKLRELVDTA
Ga0066906_11214520Ga0066906_112145202F081964MCRASGRSSVSQPVDCYRHAIIRAVTGNRPAIVWNVTDCAALDRICERLAEAERAFEILRAKGHGRPGLLLHEVAALVPDVK*
Ga0066906_11253533Ga0066906_112535331F031319SRVPRPLASLLSLSMREGETLKTYSDRYWEMFNEIDDDIDDIAISTFKLGLPAEHGLRKSLTRKPVTSIRQLMDRIDKYKKVEED*
Ga0066906_11256232Ga0066906_112562321F031319YWEMFNEIEGEHDDVAISTFQAGLPTDHDLRKSLTSKPVTSVHQLMDRIDKYRRVEEDQL
Ga0066906_11291615Ga0066906_112916152F031319KTYSDRYWEMYNEIDGDFDDMAINTFKVGLPAEHDLRKSLTSKPVASVIQLVDRIDKYKRVEEDQQ*
Ga0066906_11304490Ga0066906_113044901F031319LDKYWEMYNEMNDNFDNIAINTFKNNLPAEHNLRKSLIGKLATSVCQLMDRIDKYKRVEEDQL*
Ga0066906_11309272Ga0066906_113092721F010514DEIGQKSENKILVPNSVPTQPGQENSEENCKKIQKLIKPLPGIIFSQNRIR*
Ga0066906_11335915Ga0066906_113359152F031319MFNEIDGDFDDVAIRTFKVGVPAEHGLRKSLTGKPANSVRQLMDRIDKYKRVKEDQQ*
Ga0066906_11341659Ga0066906_113416592F031319MFNEIDGEFIDVAIRTFKVNLPAEHGLRKSLTEKPTTSV*QLMDMIDKYKRVKEDQQQG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.