Basic Information | |
---|---|
Family ID | F031884 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 181 |
Average Sequence Length | 44 residues |
Representative Sequence | ELDENARLRKELEEARAKLDAIANIERSLNERKPGNSGR |
Number of Associated Samples | 166 |
Number of Associated Scaffolds | 181 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.26 % |
% of genes near scaffold ends (potentially truncated) | 95.03 % |
% of genes from short scaffolds (< 2000 bps) | 89.50 % |
Associated GOLD sequencing projects | 155 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.006 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.442 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.309 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.541 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 181 Family Scaffolds |
---|---|---|
PF00158 | Sigma54_activat | 47.51 |
PF00072 | Response_reg | 45.86 |
PF02954 | HTH_8 | 1.66 |
PF02397 | Bac_transf | 0.55 |
PF13440 | Polysacc_synt_3 | 0.55 |
PF00884 | Sulfatase | 0.55 |
PF00733 | Asn_synthase | 0.55 |
PF03720 | UDPG_MGDP_dh_C | 0.55 |
PF02518 | HATPase_c | 0.55 |
PF07940 | Hepar_II_III | 0.55 |
COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
---|---|---|---|
COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG5360 | Uncharacterized conserved protein, heparinase superfamily | General function prediction only [R] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.01 % |
Unclassified | root | N/A | 20.99 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2029527000|GBANfinal_contig65533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 586 | Open in IMG/M |
3300001545|JGI12630J15595_10011460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1915 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101328909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 610 | Open in IMG/M |
3300004634|Ga0066906_10064694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2023 | Open in IMG/M |
3300004801|Ga0058860_11455750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 549 | Open in IMG/M |
3300005174|Ga0066680_10830251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 554 | Open in IMG/M |
3300005457|Ga0070662_100640829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
3300005531|Ga0070738_10271195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 727 | Open in IMG/M |
3300005533|Ga0070734_10892838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 504 | Open in IMG/M |
3300005557|Ga0066704_10864774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 560 | Open in IMG/M |
3300005569|Ga0066705_10021220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3352 | Open in IMG/M |
3300005607|Ga0070740_10228319 | Not Available | 768 | Open in IMG/M |
3300005616|Ga0068852_100698784 | Not Available | 1024 | Open in IMG/M |
3300005764|Ga0066903_107133355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 579 | Open in IMG/M |
3300005841|Ga0068863_101013399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 833 | Open in IMG/M |
3300006358|Ga0068871_100881521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 829 | Open in IMG/M |
3300006864|Ga0066797_1208576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 682 | Open in IMG/M |
3300006893|Ga0073928_10575177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 799 | Open in IMG/M |
3300006893|Ga0073928_10909963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 603 | Open in IMG/M |
3300006914|Ga0075436_101310949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 548 | Open in IMG/M |
3300006954|Ga0079219_11146704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 666 | Open in IMG/M |
3300009089|Ga0099828_11583796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 577 | Open in IMG/M |
3300009093|Ga0105240_10148645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2792 | Open in IMG/M |
3300009551|Ga0105238_11241947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 770 | Open in IMG/M |
3300009553|Ga0105249_11847041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 677 | Open in IMG/M |
3300009649|Ga0105855_1223565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 573 | Open in IMG/M |
3300009792|Ga0126374_11491980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 554 | Open in IMG/M |
3300010043|Ga0126380_10657345 | Not Available | 835 | Open in IMG/M |
3300010045|Ga0126311_10326341 | Not Available | 1163 | Open in IMG/M |
3300010152|Ga0126318_10547853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 534 | Open in IMG/M |
3300010154|Ga0127503_10610329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 655 | Open in IMG/M |
3300010359|Ga0126376_13049421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 518 | Open in IMG/M |
3300010360|Ga0126372_12942277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 528 | Open in IMG/M |
3300010371|Ga0134125_12018781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 627 | Open in IMG/M |
3300010373|Ga0134128_11892681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 656 | Open in IMG/M |
3300010376|Ga0126381_100544476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1643 | Open in IMG/M |
3300010376|Ga0126381_103978685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 575 | Open in IMG/M |
3300010397|Ga0134124_12066386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 608 | Open in IMG/M |
3300011120|Ga0150983_12856375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 603 | Open in IMG/M |
3300012212|Ga0150985_118050852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 580 | Open in IMG/M |
3300012356|Ga0137371_10976069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
3300012469|Ga0150984_114320441 | Not Available | 940 | Open in IMG/M |
3300012904|Ga0157282_10135837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 733 | Open in IMG/M |
3300013105|Ga0157369_10173513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2271 | Open in IMG/M |
3300013307|Ga0157372_10709191 | Not Available | 1171 | Open in IMG/M |
3300014201|Ga0181537_10670079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 706 | Open in IMG/M |
3300014201|Ga0181537_10719621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 678 | Open in IMG/M |
3300015053|Ga0137405_1309700 | Not Available | 6547 | Open in IMG/M |
3300015264|Ga0137403_10645197 | Not Available | 921 | Open in IMG/M |
3300015374|Ga0132255_104293119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 604 | Open in IMG/M |
3300016341|Ga0182035_11897245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 540 | Open in IMG/M |
3300016387|Ga0182040_11134419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 656 | Open in IMG/M |
3300016445|Ga0182038_10336679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1246 | Open in IMG/M |
3300017930|Ga0187825_10095348 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300017959|Ga0187779_10071756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2046 | Open in IMG/M |
3300017961|Ga0187778_10191278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
3300017961|Ga0187778_10261660 | Not Available | 1113 | Open in IMG/M |
3300017970|Ga0187783_11293434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 525 | Open in IMG/M |
3300017973|Ga0187780_10943134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 628 | Open in IMG/M |
3300018058|Ga0187766_10828709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 648 | Open in IMG/M |
3300018060|Ga0187765_11108339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 550 | Open in IMG/M |
3300018089|Ga0187774_11297362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
3300018431|Ga0066655_10014943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3478 | Open in IMG/M |
3300019260|Ga0181506_1212698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 528 | Open in IMG/M |
3300020069|Ga0197907_10208134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 537 | Open in IMG/M |
3300020581|Ga0210399_11471994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 529 | Open in IMG/M |
3300021151|Ga0179584_1241507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 818 | Open in IMG/M |
3300021171|Ga0210405_10187514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1640 | Open in IMG/M |
3300021181|Ga0210388_10145963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2053 | Open in IMG/M |
3300021315|Ga0179958_1101691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 557 | Open in IMG/M |
3300021362|Ga0213882_10226318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 774 | Open in IMG/M |
3300021420|Ga0210394_11042053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 707 | Open in IMG/M |
3300021432|Ga0210384_10859849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 806 | Open in IMG/M |
3300021439|Ga0213879_10187681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 611 | Open in IMG/M |
3300021441|Ga0213871_10185989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 644 | Open in IMG/M |
3300021476|Ga0187846_10221626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 790 | Open in IMG/M |
3300021559|Ga0210409_10039695 | All Organisms → cellular organisms → Bacteria | 4473 | Open in IMG/M |
3300021559|Ga0210409_11194255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 636 | Open in IMG/M |
3300021560|Ga0126371_13470252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 532 | Open in IMG/M |
3300022531|Ga0242660_1149122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 611 | Open in IMG/M |
3300022531|Ga0242660_1252887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 503 | Open in IMG/M |
3300025898|Ga0207692_10921566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 575 | Open in IMG/M |
3300025911|Ga0207654_10747055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 705 | Open in IMG/M |
3300025913|Ga0207695_10106309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2792 | Open in IMG/M |
3300025915|Ga0207693_11348149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 532 | Open in IMG/M |
3300025919|Ga0207657_10804348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 727 | Open in IMG/M |
3300025920|Ga0207649_10190848 | Not Available | 1441 | Open in IMG/M |
3300025922|Ga0207646_10684979 | Not Available | 917 | Open in IMG/M |
3300025923|Ga0207681_11793682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 512 | Open in IMG/M |
3300025924|Ga0207694_10883954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 755 | Open in IMG/M |
3300025933|Ga0207706_11344576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 589 | Open in IMG/M |
3300025937|Ga0207669_10933014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 727 | Open in IMG/M |
3300025961|Ga0207712_10251220 | Not Available | 1429 | Open in IMG/M |
3300026035|Ga0207703_10737761 | Not Available | 938 | Open in IMG/M |
3300026078|Ga0207702_12024391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 566 | Open in IMG/M |
3300026095|Ga0207676_10760262 | Not Available | 943 | Open in IMG/M |
3300026274|Ga0209888_1090394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 545 | Open in IMG/M |
3300026277|Ga0209350_1120399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 596 | Open in IMG/M |
3300026291|Ga0209890_10287619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 500 | Open in IMG/M |
3300026300|Ga0209027_1222727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 605 | Open in IMG/M |
3300026304|Ga0209240_1071795 | Not Available | 1287 | Open in IMG/M |
3300026530|Ga0209807_1032159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2517 | Open in IMG/M |
3300026909|Ga0207858_1012460 | Not Available | 837 | Open in IMG/M |
3300027003|Ga0207722_1022501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 692 | Open in IMG/M |
3300027297|Ga0208241_1068473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 568 | Open in IMG/M |
3300027497|Ga0208199_1062279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 789 | Open in IMG/M |
3300027605|Ga0209329_1021793 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
3300027616|Ga0209106_1003281 | All Organisms → cellular organisms → Bacteria | 3102 | Open in IMG/M |
3300027826|Ga0209060_10489919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 558 | Open in IMG/M |
3300027867|Ga0209167_10237173 | Not Available | 977 | Open in IMG/M |
3300027867|Ga0209167_10768750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 525 | Open in IMG/M |
3300027869|Ga0209579_10463422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 688 | Open in IMG/M |
3300028379|Ga0268266_10483641 | Not Available | 1180 | Open in IMG/M |
3300028380|Ga0268265_11131138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 778 | Open in IMG/M |
3300028806|Ga0302221_10289386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 714 | Open in IMG/M |
3300029984|Ga0311332_11795113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 500 | Open in IMG/M |
3300030053|Ga0302177_10225406 | Not Available | 1023 | Open in IMG/M |
3300030054|Ga0302182_10115938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex | 1171 | Open in IMG/M |
3300030509|Ga0302183_10165488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 867 | Open in IMG/M |
3300030618|Ga0311354_11085045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 732 | Open in IMG/M |
3300030743|Ga0265461_10028777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1773 | Open in IMG/M |
3300030776|Ga0075396_1919399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 672 | Open in IMG/M |
3300030923|Ga0138296_1826761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 856 | Open in IMG/M |
3300031198|Ga0307500_10095863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 790 | Open in IMG/M |
3300031231|Ga0170824_114089971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 505 | Open in IMG/M |
3300031231|Ga0170824_126996146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 642 | Open in IMG/M |
3300031232|Ga0302323_101369421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 794 | Open in IMG/M |
3300031366|Ga0307506_10212498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 717 | Open in IMG/M |
3300031474|Ga0170818_107822849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 537 | Open in IMG/M |
3300031525|Ga0302326_10255302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2852 | Open in IMG/M |
3300031543|Ga0318516_10069324 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
3300031544|Ga0318534_10481359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 710 | Open in IMG/M |
3300031561|Ga0318528_10774758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 513 | Open in IMG/M |
3300031573|Ga0310915_10841136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 645 | Open in IMG/M |
3300031680|Ga0318574_10464539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 741 | Open in IMG/M |
3300031681|Ga0318572_10671713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 617 | Open in IMG/M |
3300031708|Ga0310686_113215363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 619 | Open in IMG/M |
3300031719|Ga0306917_11164376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 599 | Open in IMG/M |
3300031720|Ga0307469_10517480 | Not Available | 1050 | Open in IMG/M |
3300031747|Ga0318502_10290332 | Not Available | 960 | Open in IMG/M |
3300031764|Ga0318535_10447511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 575 | Open in IMG/M |
3300031764|Ga0318535_10486752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 549 | Open in IMG/M |
3300031770|Ga0318521_11018249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 508 | Open in IMG/M |
3300031779|Ga0318566_10551250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 563 | Open in IMG/M |
3300031781|Ga0318547_10531887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 727 | Open in IMG/M |
3300031795|Ga0318557_10482372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 570 | Open in IMG/M |
3300031799|Ga0318565_10560559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 550 | Open in IMG/M |
3300031831|Ga0318564_10167705 | Not Available | 979 | Open in IMG/M |
3300031833|Ga0310917_10930306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 584 | Open in IMG/M |
3300031846|Ga0318512_10354000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 734 | Open in IMG/M |
3300031852|Ga0307410_10209207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 1493 | Open in IMG/M |
3300031859|Ga0318527_10149709 | Not Available | 978 | Open in IMG/M |
3300031890|Ga0306925_10714898 | Not Available | 1047 | Open in IMG/M |
3300031890|Ga0306925_10851723 | Not Available | 942 | Open in IMG/M |
3300031894|Ga0318522_10260580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 657 | Open in IMG/M |
3300031902|Ga0302322_101475747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 830 | Open in IMG/M |
3300031910|Ga0306923_10110765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3106 | Open in IMG/M |
3300031945|Ga0310913_10820260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 656 | Open in IMG/M |
3300031996|Ga0308176_11983298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 622 | Open in IMG/M |
3300032009|Ga0318563_10060983 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
3300032009|Ga0318563_10268537 | Not Available | 922 | Open in IMG/M |
3300032055|Ga0318575_10564871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 577 | Open in IMG/M |
3300032076|Ga0306924_10349636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1695 | Open in IMG/M |
3300032090|Ga0318518_10147532 | Not Available | 1194 | Open in IMG/M |
3300032180|Ga0307471_104082996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 516 | Open in IMG/M |
3300032515|Ga0348332_11968818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 747 | Open in IMG/M |
3300032783|Ga0335079_10205354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2184 | Open in IMG/M |
3300032892|Ga0335081_10865497 | Not Available | 1070 | Open in IMG/M |
3300032896|Ga0335075_10407892 | Not Available | 1441 | Open in IMG/M |
3300032896|Ga0335075_10752501 | Not Available | 924 | Open in IMG/M |
3300032898|Ga0335072_10295599 | Not Available | 1819 | Open in IMG/M |
3300032898|Ga0335072_11360396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 617 | Open in IMG/M |
3300032954|Ga0335083_10548103 | Not Available | 961 | Open in IMG/M |
3300033134|Ga0335073_10319622 | Not Available | 1853 | Open in IMG/M |
3300033158|Ga0335077_10518532 | Not Available | 1258 | Open in IMG/M |
3300033158|Ga0335077_11626244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 613 | Open in IMG/M |
3300034671|Ga0314796_051618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 786 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.44% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.42% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.87% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.87% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.87% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.31% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.21% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.21% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.21% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.21% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.66% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.66% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.66% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.66% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.66% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.10% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.10% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.10% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.10% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.10% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.10% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.10% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.10% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.10% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.10% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.55% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.55% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.55% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.55% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.55% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.55% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.55% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.55% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.55% |
Green-Waste Compost | Engineered → Solid Waste → Grass → Composting → Bioreactor → Green-Waste Compost | 0.55% |
Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2029527000 | Green-waste compost microbial community at University of California, Davis, USA, from solid state bioreactor - Inoculum 16S MiniPCR | Engineered | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004634 | High solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-1D-10D | Engineered | Open in IMG/M |
3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026274 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
3300027003 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030776 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GBAN_790380 | 2029527000 | Green-Waste Compost | RLRKALDEALAKLDAIANIERSLSERKPNSEGRSP |
JGI12630J15595_100114601 | 3300001545 | Forest Soil | LQAEMDENVRLRRELEEARAKLDAIANIERSLNERKPGTGGR* |
JGIcombinedJ26739_1013289091 | 3300002245 | Forest Soil | AELDENARLRKELDEARAKLAAIANIERSLNERKPGTTGH* |
Ga0066906_100646943 | 3300004634 | Ionic Liquid And High Solid Enriched | ADRERLAAVNKRLQAELDENARLRKELSEARAKLDAIANIEKSLSERKPNTEGRTQ* |
Ga0058860_114557501 | 3300004801 | Host-Associated | NRRLQLETDENARLRKELEEARAKLDAIANIERSLNERKPSNEGRQP* |
Ga0066680_108302511 | 3300005174 | Soil | LQAEMDENTRLRRELEEARAKLDAIANIERSLNERKPGSTGR* |
Ga0070662_1006408292 | 3300005457 | Corn Rhizosphere | TDENARLRKELEEARAKLDAIANIERSLNERKPNTEGRQP* |
Ga0070738_102711952 | 3300005531 | Surface Soil | REHIANANHRLQAEVDENARLRKELDEARAKLAAIANIERSLNERKPGTTPHQ* |
Ga0070734_108928382 | 3300005533 | Surface Soil | ELDENAQLRKDLDEAHAKLDAIANIERSLNKRKPGTEGPTP* |
Ga0066704_108647742 | 3300005557 | Soil | RLQLESDENARLRKELEEARAKLDAIANIERSLNERKPSNEGRPQ* |
Ga0066705_100212204 | 3300005569 | Soil | DENTRLRRELEEARAKLDAIANIERSLNERKPGSTGR* |
Ga0070740_102283192 | 3300005607 | Surface Soil | LEAEAEENAKLHKELDEARAKLDAIANIERSLNSRKSRKEGSTQ* |
Ga0068852_1006987842 | 3300005616 | Corn Rhizosphere | KLKKQLEEAKAKLAAIANIEKSLNERKPGNEGRPK* |
Ga0066903_1071333552 | 3300005764 | Tropical Forest Soil | LRKELDEARAKLDAIANIERSLNERKPGNTTPRP* |
Ga0068863_1010133991 | 3300005841 | Switchgrass Rhizosphere | ALNKRLQTETDENARLRKELDEARAKLDAIANIESTLNQRKPKQ* |
Ga0068871_1008815212 | 3300006358 | Miscanthus Rhizosphere | AEIDENARLRKELEEAQSKLDAISDIEKSLSERKSSAESRSP* |
Ga0066797_12085761 | 3300006864 | Soil | RLRRELDEARAKLDAIANIERSLNERKPSTEGRQP* |
Ga0073928_105751772 | 3300006893 | Iron-Sulfur Acid Spring | ETDENGRLRKELEEARAKLDAIANIERSLNERKPSNEGRPQ* |
Ga0073928_109099631 | 3300006893 | Iron-Sulfur Acid Spring | LRKELEEARAKLDAIANIERSLNERKPSNEGRQP* |
Ga0075436_1013109491 | 3300006914 | Populus Rhizosphere | LQTEMDENARLRKELEEARAKLDAIANIERSLNERKPGSSGR* |
Ga0079219_111467042 | 3300006954 | Agricultural Soil | ENARLRKELEEARAKLDAIANIERSLNERKPGSSGR* |
Ga0099828_115837961 | 3300009089 | Vadose Zone Soil | RLRKELDEARAKLDAIANIERSLNERKPSNEGRQP* |
Ga0105240_101486453 | 3300009093 | Corn Rhizosphere | HRLQLETDENVRLRKELEEARAKLDAIANIERSLNERKPNNEGRPQ* |
Ga0105238_112419472 | 3300009551 | Corn Rhizosphere | ANVNHRLQLETDENTRLRKELEEARAKLDAIANIERSLNERKPGNTGRPQ* |
Ga0105249_118470412 | 3300009553 | Switchgrass Rhizosphere | SAMSREDRDKLAALNKRLQTETDENARLRKDLEEAQKKLDAVANIERSLNDRKP* |
Ga0105855_12235652 | 3300009649 | Permafrost Soil | KLRKDLEDARAKLDAITNIERSLNDRKANTEGHTP* |
Ga0126374_114919802 | 3300009792 | Tropical Forest Soil | ENARLRKELEEARAKLDAIANIERSLNERKPSNTGRPQ* |
Ga0126380_106573451 | 3300010043 | Tropical Forest Soil | ALVANVNHRLQQEMDENARLRKELEEARAKLDAISNIERSLNERKPAAPTPR* |
Ga0126311_103263411 | 3300010045 | Serpentine Soil | ENARLRKELNEARAKLDAIANIERSLNERKPAPEGRSP* |
Ga0126318_105478532 | 3300010152 | Soil | VNHRLQLETDENAWLRKELEEARAKLDAIANIERSLNERKPSNTGRPQ* |
Ga0127503_106103292 | 3300010154 | Soil | REHVASANHRLQTELDENARLRKELDEARAKLDAIANIERSLNERKPGSSGR* |
Ga0126376_130494212 | 3300010359 | Tropical Forest Soil | AANKRLQAEIDENARLRKELEEAQAKLDAISDIEKSLSERKPSAESRPP* |
Ga0126372_129422772 | 3300010360 | Tropical Forest Soil | ARLDRERQGSANRRLQVEMDENARLRKELEEARAKLDAIANIERSLNERKPNNQGPQP* |
Ga0134125_120187811 | 3300010371 | Terrestrial Soil | GENVKLKKQLEEAKAKLAAIANIEKSLNERKPGNEGRPK* |
Ga0134128_118926811 | 3300010373 | Terrestrial Soil | NHRLQLETDENARLRKELEEARAKLDAIANIERSLNERKPGNTGRPQ* |
Ga0126381_1005444761 | 3300010376 | Tropical Forest Soil | HRLQAELDENARLRKELEEARAKLDAIANIERSLNERKPGNSGR* |
Ga0126381_1039786852 | 3300010376 | Tropical Forest Soil | EHVASANHRLQAELDENTRLRKELEEARAKLDAIANIERSLNERKPGNSGR* |
Ga0134124_120663861 | 3300010397 | Terrestrial Soil | SELEENARLRKELEAAQAKLDAVSDIERSLSERKSSAESRTP* |
Ga0150983_128563751 | 3300011120 | Forest Soil | NRRLQAELDENARLRKELDDARAKLDAIANIERSLNERKPANTTPHQ* |
Ga0150985_1180508521 | 3300012212 | Avena Fatua Rhizosphere | IWERLANVNHRLQLETDENGRLRKELEEARAKLDAIANIERSLNERKPSNTGRPQ* |
Ga0137371_109760692 | 3300012356 | Vadose Zone Soil | MDENTRLRRELEEARAKLDAIANIERSLNERKPGSTGR* |
Ga0150984_1143204411 | 3300012469 | Avena Fatua Rhizosphere | VNRRLQLETDENARLRKELEEARAKLDAIANIERSLNERKPNNEGRQP* |
Ga0157282_101358371 | 3300012904 | Soil | SELDENLRLRKALDEANAKLNAIANIEQSINERKSGTEGRSP* |
Ga0157369_101735131 | 3300013105 | Corn Rhizosphere | RLRKELEEARAKLDAIANIERSLNERKPSNTGRPQ* |
Ga0157372_107091912 | 3300013307 | Corn Rhizosphere | LRKELEEARAKLDAIANIERSLNERKPTNEGRQP* |
Ga0181537_106700792 | 3300014201 | Bog | QVETDENARLRKELEEARAKLDAIANIERSLNERKPSNEGRQP* |
Ga0181537_107196211 | 3300014201 | Bog | NTRLQAEADENARLRKELDEARAKLAAIANIERSLNERKPGTTGH* |
Ga0137405_13097008 | 3300015053 | Vadose Zone Soil | LRKEISEAQAKLDAISDIEKSLSERKSSAESRAP* |
Ga0137403_106451972 | 3300015264 | Vadose Zone Soil | QLETDENARLRKELDEARAKLDAIANIERSLNERKPSNEGRKP* |
Ga0132255_1042931191 | 3300015374 | Arabidopsis Rhizosphere | RLQEEVAENARLRKELEEAQAKLDAISDIEKSLSERKSSAESRSP* |
Ga0182035_118972452 | 3300016341 | Soil | RLQTELDENARLRKELEEARAKLDAIANIERSLNERKPGSAGR |
Ga0182040_111344192 | 3300016387 | Soil | AELDENTRLRKELEEARAKLDAIANIERSLNERKPGSAGR |
Ga0182038_103366792 | 3300016445 | Soil | DENARLRKDLEEARAKLDAIANIERSLNERKPGSSGR |
Ga0187825_100953482 | 3300017930 | Freshwater Sediment | ASANHRLQSEMDENARLRKELDEARAKLDAIANIERSLNERKPGSSGR |
Ga0187779_100717563 | 3300017959 | Tropical Peatland | LQTELDENARLRKELDEARAKLDAIANIERSLNERKPNTTTPHP |
Ga0187778_101912782 | 3300017961 | Tropical Peatland | ELDENAKLKKDLDEAHAKLEAIANMERSLNKRKPGAEGATQ |
Ga0187778_102616602 | 3300017961 | Tropical Peatland | ADRERLTSANHRLQAEMDENARLRKELEEARAKLDAIATIERSLSERKPGSTGRQP |
Ga0187783_112934342 | 3300017970 | Tropical Peatland | AELDENARLRRELEEARAKLDAIANIERSVNERKPDSTGR |
Ga0187780_109431342 | 3300017973 | Tropical Peatland | ENARLRKEIEEMRAKLDAIANIERQLNERKPDTTGRTP |
Ga0187859_106767381 | 3300018047 | Peatland | LHRLQAEMDENAKLRKQLEDAQAKLDAIANIERNLTQRKSANEGGQP |
Ga0187766_108287092 | 3300018058 | Tropical Peatland | HADLQRQTTANHRLQAELDENARLRKELEEARAKLDAIANIERSLNERKPTATGHTP |
Ga0187765_111083391 | 3300018060 | Tropical Peatland | RLQAEMDENARLRKELEEARAKLDAISNIERSLSERKPAAPPK |
Ga0187774_112973621 | 3300018089 | Tropical Peatland | AAARRVAEEAQAKLDAIANIERNISERKSGSGGRKP |
Ga0066655_100149434 | 3300018431 | Grasslands Soil | DENARLRRELEEARAKLDAIANIERSLNERKPGSTGR |
Ga0181506_12126981 | 3300019260 | Peatland | DRERLANANHRLQLETDENGRLRKELEEARAKLDAIANIERSLNERKPSNEGRPQ |
Ga0197907_102081342 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VNRRLQLETDENARLRKELEEARAKLDAIANIERSLNERKPSNEGRPQ |
Ga0210399_114719942 | 3300020581 | Soil | NANHRLQAEMDENVRLRRELEEARAKLDAIANIERSLNERKPGSTGR |
Ga0179584_12415072 | 3300021151 | Vadose Zone Soil | RLANVNHRLQLETDENGHLRKELEEARAKLDAIANIERSLNERKPSNEGRSQ |
Ga0210405_101875141 | 3300021171 | Soil | DENARLRKEIEEARAKLDAIANIERSLNERKPGSSGR |
Ga0210388_101459631 | 3300021181 | Soil | NHRLQAELDENARLRKELDEARAKLAAIANIERSLNERKPGTTTH |
Ga0179958_11016912 | 3300021315 | Vadose Zone Soil | VNRRLQLETDENARLRKELDEARAKLDAIANIERSLNERKPSNEGRQP |
Ga0213882_102263182 | 3300021362 | Exposed Rock | NARLRKELDEARAKLDAIANIERSLNERKPNNQGSQP |
Ga0210394_110420532 | 3300021420 | Soil | SANHRLQAELDENARLRKELDEARAKLAAIANIERSLNERKSGTGHQ |
Ga0210384_108598492 | 3300021432 | Soil | LQAEALRADHERTASANHRLQAELDENARLRKELDEARAKLAAIANIERSLNERKSGTGH |
Ga0213879_101876811 | 3300021439 | Bulk Soil | VTALNKRLQSEADENAQLRKDLDEAHAKLDAIANIERSLNKRKPGTEGSSP |
Ga0213871_101859891 | 3300021441 | Rhizosphere | NVRLRKELDEARAKLDAIANIERSVNERKPGTTGR |
Ga0187846_102216262 | 3300021476 | Biofilm | AANRRLQAELEENTRLRKELDEARAKLDAIANIERSLNERKPGTTTPHP |
Ga0210409_100396951 | 3300021559 | Soil | ENARLRKDLEEARAKLDAIANIERSLNERKPGNTGR |
Ga0210409_111942552 | 3300021559 | Soil | VANANHRLQAEMDENGRLRRELEEARAKLDAIANIERSLNERKPGSTGR |
Ga0126371_134702521 | 3300021560 | Tropical Forest Soil | RLQSETDENARLRKELDEARAKLDAIANIERSLNERKPSNEGRPP |
Ga0242660_11491222 | 3300022531 | Soil | DQARTAAANRRLQAEIEENTHLRKELEEARAKLDAIANIELNQRKPGATTPHP |
Ga0242660_12528871 | 3300022531 | Soil | LANVNHRLQAETDENTRLRKELEEARAKLDAIANIERSLNERKPSNEGRPQ |
Ga0207692_109215662 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | QTEMDENARLRKELDEARAKLDAIANIERSLNERKPGSSGR |
Ga0207654_107470551 | 3300025911 | Corn Rhizosphere | TVNRRLQLETDENARLRKELEEARAKLDAIANIERSLNERKPNTEGRQP |
Ga0207695_101063091 | 3300025913 | Corn Rhizosphere | HRLQLETDENVRLRKELEEARAKLDAIANIERSLNERKPNNEGRPQ |
Ga0207693_113481491 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RADHERTASANHRLQAELDENARLRKELDEARAKLAAIANIERSLNERKSGTGHQ |
Ga0207657_108043481 | 3300025919 | Corn Rhizosphere | LQLETDENARLRKELEEARAKLDAIANIERSLNERKPSNTGRPQ |
Ga0207649_101908482 | 3300025920 | Corn Rhizosphere | ETDENARLRKELEEARAKLDAIANIERSLNERKPSNEGRQP |
Ga0207646_106849792 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | HRLQAELDENARLRKELDEARAKLAAIANIERSLNERKSGTGHQ |
Ga0207681_117936821 | 3300025923 | Switchgrass Rhizosphere | ENRRLQSAMSREDRDKLAALNKRLQTETDENARLRKDLEEAQKKLDAVANIERSLNDRKP |
Ga0207694_108839541 | 3300025924 | Corn Rhizosphere | ATSNRRLQLETDEYARLRKELEEARAKLDAIANIERSLNERKPSNEGRQP |
Ga0207706_113445761 | 3300025933 | Corn Rhizosphere | TDENARLRKELEEARAKLDAIANIERSLNERKPNTEGRQP |
Ga0207669_109330141 | 3300025937 | Miscanthus Rhizosphere | AELDENARLRRELDEARAKLAAIANIERSLNERKPGTGK |
Ga0207712_102512202 | 3300025961 | Switchgrass Rhizosphere | DENARLRKELDAAQAKLDAISDIERSLSERKPSAESRTP |
Ga0207703_107377612 | 3300026035 | Switchgrass Rhizosphere | NARLHKELDEARAKLDAITNIERSLNERKPSTEGHTP |
Ga0207702_120243911 | 3300026078 | Corn Rhizosphere | LASVNHRLQLETDENTRLRKELEEARAKLDAIANIERSLNERKPSNTGRPQ |
Ga0207676_107602622 | 3300026095 | Switchgrass Rhizosphere | SSSLRLQTEMDENARLRKELDEARAKLDAIATVEQNITDRKPTTEGRRP |
Ga0209888_10903941 | 3300026274 | Permafrost Soil | KLRKDLEDARAKLDAITNIERSLNDRKANTEGHTP |
Ga0209350_11203991 | 3300026277 | Grasslands Soil | AELDENTRLRRELEEARAKLDAIANIERSLNERKPGSTGR |
Ga0209890_102876191 | 3300026291 | Soil | AKLRRELDEARAKLDAISHIERSINDRATSATGVTAK |
Ga0209027_12227271 | 3300026300 | Grasslands Soil | ANANHRLQAEMDENTRLRRELEEARAKLDAIANIERSLNERKPGSTGR |
Ga0209240_10717951 | 3300026304 | Grasslands Soil | NTRLRRELEEARAKLDAIANIERSLNERKPGSTGR |
Ga0209807_10321591 | 3300026530 | Soil | LRMANANHRLQAELDENTRLRRELEEARAKLDAIANIERSLNERKPGSTGR |
Ga0207858_10124602 | 3300026909 | Tropical Forest Soil | DRERVASANHRLQAEQDENARLRKDLEEARAKLDAIANIERSLNERKPGSSGR |
Ga0207722_10225011 | 3300027003 | Tropical Forest Soil | ENARLRKELDEARAKLDAIANIERSLNERKPGTTPRP |
Ga0208241_10684732 | 3300027297 | Forest Soil | AVRADREHIANANHRLQAELDENARLRKELDEARAKLAAIANIERSLNERKPGTTTH |
Ga0208199_10622792 | 3300027497 | Peatlands Soil | ASTQRRLQTELDENARLRKQLEDAQAKLDAIANIERNLTERKPANEGGQP |
Ga0209329_10217932 | 3300027605 | Forest Soil | HRLQAEMDENVRLRRELEEARAKLDAIANIERSLNERKPGSTGR |
Ga0209106_10032811 | 3300027616 | Forest Soil | NHRLQAEMDENVRLRRELEEARAKLDAIANIERSLNERKPGSTGR |
Ga0209060_104899192 | 3300027826 | Surface Soil | LQVEADENARLRKELEEARAKLDAIANIERSLNERKPNNQGSQP |
Ga0209167_102371732 | 3300027867 | Surface Soil | ENTRLRKELEEARAKLDAIANIERSLNERKPNNEGRLP |
Ga0209167_107687501 | 3300027867 | Surface Soil | HRLQAELDENARLRKELDEARAKLAAIANIERSLNERKPGTTTH |
Ga0209579_104634222 | 3300027869 | Surface Soil | ENAQLRKDLDEAHAKLDAITNIERSLNKRKPGTEGSAP |
Ga0268266_104836412 | 3300028379 | Switchgrass Rhizosphere | RRRKELEEARAKLDAIANIERSLNERKPSNEGRQP |
Ga0268265_111311382 | 3300028380 | Switchgrass Rhizosphere | VDENARLRKELDAAQAKLDAISDIERSLSERKPSAESRTP |
Ga0302221_102893862 | 3300028806 | Palsa | RADREHIAKANSRLQAEADENARLRKELDEARAKLAAIANIERSLNERKPGTTGH |
Ga0311332_117951132 | 3300029984 | Fen | RRMQQELDDNARLRRQLAEAQAKLDAIANIERNLTERKGNNGVSTK |
Ga0302177_102254061 | 3300030053 | Palsa | SEIDENAKLRKDLEEARAKLDAITNIERSLDDRKPSTEGHTP |
Ga0302182_101159381 | 3300030054 | Palsa | KHLQAEIDENARLRKELDEAHAKLDAITNIERSLNDRKPSTEGHTP |
Ga0302183_101654882 | 3300030509 | Palsa | ARADREHIAKANSRLQAEADENARLRKELDEARAKLAAIANIERSLNERKPGTTGH |
Ga0311354_110850452 | 3300030618 | Palsa | RERLANVNHRLQLETDENARLHKELEEARAKLDAIANIERSLNERKPSNEGRPQ |
Ga0265461_100287771 | 3300030743 | Soil | RMQAELDENARLRKELDEARAKLQAIFNIERSLNERKPGDAGR |
Ga0075396_19193992 | 3300030776 | Soil | LETDENARLRKELEEARAKLDAIANIERSLNERKPNNEGRQP |
Ga0138296_18267611 | 3300030923 | Soil | ADRERLANVNHRLQLETDENARLHKELEEARAKLDAIANIDRSLNERKPSNEGRPQ |
Ga0307500_100958631 | 3300031198 | Soil | NIRLRKELDAAQAKLDAISDIEKSLSDRKPSAESRSP |
Ga0170824_1140899711 | 3300031231 | Forest Soil | ARLRKELDEARAKLDAIANIERSLNERKPNNEGRQP |
Ga0170824_1269961461 | 3300031231 | Forest Soil | LETDENARLRKELDEARAKLDAIANIERSLNERKPNNEGRQP |
Ga0302323_1013694211 | 3300031232 | Fen | LARQLKAEMDENARLKKELDDAKAKLEAIANIERSIPARPPVNEARKP |
Ga0302325_109452141 | 3300031234 | Palsa | RRLQSELDENARLRKQLEDAQAKLDAIAKIERNLTQRKPGNEGAQP |
Ga0307506_102124981 | 3300031366 | Soil | LQTEMDENARLRKALDEARAKLDAIANIERSISDRPPATEGRPQ |
Ga0170818_1078228491 | 3300031474 | Forest Soil | NRRLQLETDENARLRKELEEARAKLDAIANIERSLNERKPSNEGRQP |
Ga0302326_102553023 | 3300031525 | Palsa | ANRHLQTEIDENTKLRKDLEDARAKLDAITNIERSLNDRKPSTEGHTP |
Ga0318516_100693243 | 3300031543 | Soil | RLQTEVDENARLRKELEEARAKLDAIANIERSLNERKPGNSGR |
Ga0318534_104813592 | 3300031544 | Soil | ELDENARLRKELDEARAKLDAIANIERSLNERKPGSSGR |
Ga0318528_107747581 | 3300031561 | Soil | AELDENARLRKELEEARAKLDAIANIERSLNERKPGNSGR |
Ga0310915_108411361 | 3300031573 | Soil | RLQAELDENTRLRKELEEARAKLDAIANIERSLNERKPGSAGR |
Ga0318561_102670312 | 3300031679 | Soil | MDENAKLRKELDEAHAKLEAIANIERSLNKRKPPGEGSTP |
Ga0318574_104645391 | 3300031680 | Soil | ASANHRLQTELDENARLRKELDEARAKLDAIANIERSLNERKPGSSGR |
Ga0318572_106717131 | 3300031681 | Soil | DENTRLRKELEEARAKLDAIANIERSLNERKPGSSGR |
Ga0310686_1112125822 | 3300031708 | Soil | RRLQAELDENARLRKQLEDAQSKLDAIANIERNLTQRKPAPEGGQP |
Ga0310686_1132153631 | 3300031708 | Soil | NRKLQIEIDENARLRKELDDAQAKLDAIANIERSLEKRKPNPEGQTP |
Ga0306917_111643761 | 3300031719 | Soil | ANHRLQAELDENTRLRKELEEARAKLDAIANIERSLNERKPGSAGR |
Ga0307469_105174801 | 3300031720 | Hardwood Forest Soil | LQLETDENARLRKELEEARAKLDAIANIERSLNERKPNNQGPQP |
Ga0318502_102903322 | 3300031747 | Soil | ASANHRLQAELDENARLRKELEEARAKLDAIANIERSLNERKPGNSGR |
Ga0318535_104475112 | 3300031764 | Soil | ENARLRKELEEARAKLDAIANIERSLNERKPGNSGR |
Ga0318535_104867521 | 3300031764 | Soil | RADREHIATAKNRLQVEMDENARLRKELDEARAKLDAIANIERSLNERKPGSSGR |
Ga0318521_110182492 | 3300031770 | Soil | LQAEQDENARLRKDLEEARAKLDAIANIERSLNERKPGSSGR |
Ga0318566_105512502 | 3300031779 | Soil | DENARLRKELEEARAKLDAIANIERSLNERKPGNSGR |
Ga0318547_105318871 | 3300031781 | Soil | ANHRLQTELDENARLRKELEEARAKLDAIANIERSLNERKPGNSGR |
Ga0318557_104823722 | 3300031795 | Soil | HRLQAELDENARLRKELEEARAKLDAIANIERSLNERKPGTGR |
Ga0318565_105605591 | 3300031799 | Soil | LQVEMDENARLRKELDEARAKLDAIANIERSLNERKPGSSGR |
Ga0318564_101677052 | 3300031831 | Soil | HRLQTELDENARLRKELDEARAKLDAIANIERSLNERKPGSSGR |
Ga0310917_109303062 | 3300031833 | Soil | LDENARLRKELEEARAKLDAIANIERSLNERKPGNSGR |
Ga0318512_103540001 | 3300031846 | Soil | ADREHVATANHRLQAEMDENARLRKDLEEARAKLDAIANIERSLNERKPGSSGR |
Ga0307410_102092071 | 3300031852 | Rhizosphere | NRRLQTEMEESARLRKALDEAKAKLDAITRMERNLPDRPPAPEGRNP |
Ga0318527_101497092 | 3300031859 | Soil | HIATAKNRLQVEMDENARLRKELDEARAKLDAIANIERSLNERKPGSSGR |
Ga0306925_107148981 | 3300031890 | Soil | DENARLRKELEEARAKLDAIANIERSLNERKPGTGR |
Ga0306925_108517231 | 3300031890 | Soil | KLRKELDEAHAKLEAIANIERSLNKRKPPGEGSTP |
Ga0318522_102605802 | 3300031894 | Soil | VDREHVASANHRLQAELDENTRLRKELEEARAKLDAIANIERSLNERKPGSAGR |
Ga0302322_1014757472 | 3300031902 | Fen | ESARLRKLVDDAQAKLAAIATLEKTLSERKPNSEGRKK |
Ga0306923_101107651 | 3300031910 | Soil | LQTELDENARLRKELDEARAKLDAIANIERSLNERKPGSSGR |
Ga0310913_108202602 | 3300031945 | Soil | NRLQAELDENARLRKELEEARAKLDAIANIERSLNERKPGNSGR |
Ga0308176_119832982 | 3300031996 | Soil | EVEENTRLRKELDEAQAKLDAISDIEKSLSERKSSAESRSP |
Ga0318563_100609831 | 3300032009 | Soil | LQTEVDENARLRKELEEARAKLDAIANIERSLNERKPGNSGR |
Ga0318563_102685371 | 3300032009 | Soil | ELDENARLRKELEEARAKLDAIANIERSLNERKPGNSGR |
Ga0318575_105648712 | 3300032055 | Soil | HRLQAEMDENTRLRKELEEARAKLDAIANIERSLNERKPGSSGR |
Ga0306924_103496363 | 3300032076 | Soil | HVATANHRLQAEMDENARLRKDLEEARAKLDAIANIERSLNERKPGSSGR |
Ga0318518_101475322 | 3300032090 | Soil | ARLRKELDEAHAKLDAIANIERSLNKRRPPTEGPTQGPTQ |
Ga0307471_1040829961 | 3300032180 | Hardwood Forest Soil | ENARLRKELDEARAKLDAIANIERSLNERKPNNEGRQP |
Ga0348332_119688182 | 3300032515 | Plant Litter | ANVNHRLQLETDENARLHKELEEARANLDAIANIERSLNERKPSNEGRPQ |
Ga0335079_102053543 | 3300032783 | Soil | LQSEQEDNARLRKELEDAHAKLDAIANIERSLNKRKPRAEGSTQ |
Ga0335081_108654972 | 3300032892 | Soil | QAELDENAKLRKELEEAHAKLDAIANIERSLNERKPGTTTPHP |
Ga0335075_104078922 | 3300032896 | Soil | KNAKLKRQLEEARAKLAAIANIEKSLNERKPGRPK |
Ga0335075_107525012 | 3300032896 | Soil | GENQKLKKQLGEARAKLAAIANIEKSLNERKPGRPK |
Ga0335072_102955991 | 3300032898 | Soil | KLKKELQEARAKLAAIANIEKSLNERKPGNEGKPK |
Ga0335072_113603961 | 3300032898 | Soil | ANRRQQSEQSEQEENAHLRKELEELHAKLDAIANIERSLSKRKNGTEGSTP |
Ga0335083_105481032 | 3300032954 | Soil | DENARLKKALDEARAKLDAIYNIERNLNERTNAPAGEGRNP |
Ga0335073_103196221 | 3300033134 | Soil | NRRLQVEVEENSRLRKELEEARAKLDAIANIERSLNERKPGSTTPHP |
Ga0335077_105185322 | 3300033158 | Soil | LQTEMDENARLRKEIEEMRAKLDAIANIERQLNERKPDSTGRIP |
Ga0335077_116262441 | 3300033158 | Soil | EMDENARLRKELDEARAKLDAIANIERSLNERKPGSSGR |
Ga0314796_051618_595_774 | 3300034671 | Soil | VVRNDKDRNAAANKRLQAEIDENARLRKELEEAQAKLDAISDIEKSLSERKSSAESRSP |
⦗Top⦘ |