Metagenome / Metatranscriptome Family F027211

Basic Information
Family ID	F027211
Family Type	Metagenome / Metatranscriptome
Number of Sequences	195
Average Sequence Length	42 residues
Representative Sequence	MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAM
Number of Associated Samples	171
Number of Associated Scaffolds	195

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	88.54 %
% of genes near scaffold ends (potentially truncated)	35.38 %
% of genes from short scaffolds (< 2000 bps)	56.41 %
Associated GOLD sequencing projects	156
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.16

Most Common Taxonomy
Group	Bacteria (80.000 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.590 % of family members)
Environment Ontology (ENVO)	Unclassified (35.897 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (38.974 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 16.92% β-sheet: 0.00% Coil/Unstructured: 83.08%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 195 Family Scaffolds
PF07992	Pyr_redox_2	29.23
PF08534	Redoxin	7.18
PF08002	DUF1697	7.18
PF12836	HHH_3	4.10
PF02566	OsmC	2.56
PF01946	Thi4	2.05
PF12680	SnoaL_2	1.54
PF13483	Lactamase_B_3	1.54
PF00005	ABC_tran	1.54
PF12848	ABC_tran_Xtn	1.03
PF12850	Metallophos_2	1.03
PF12840	HTH_20	1.03
PF00528	BPD_transp_1	1.03
PF01909	NTP_transf_2	1.03
PF13354	Beta-lactamase2	1.03
PF01668	SmpB	1.03
PF12849	PBP_like_2	0.51
PF01197	Ribosomal_L31	0.51
PF03951	Gln-synt_N	0.51
PF02796	HTH_7	0.51
PF01012	ETF	0.51
PF12681	Glyoxalase_2	0.51
PF00069	Pkinase	0.51
PF13711	DUF4160	0.51
PF07883	Cupin_2	0.51
PF02643	DUF192	0.51
PF12697	Abhydrolase_6	0.51
PF00483	NTP_transferase	0.51
PF07963	N_methyl	0.51
PF01545	Cation_efflux	0.51
PF05724	TPMT	0.51
PF10518	TAT_signal	0.51
PF03358	FMN_red	0.51
PF01844	HNH	0.51
PF13180	PDZ_2	0.51
PF00773	RNB	0.51
PF03320	FBPase_glpX	0.51
PF00497	SBP_bac_3	0.51
PF04607	RelA_SpoT	0.51
PF04075	F420H2_quin_red	0.51
PF16326	ABC_tran_CTD	0.51
PF00903	Glyoxalase	0.51
PF03572	Peptidase_S41	0.51
PF03721	UDPG_MGDP_dh_N	0.51
PF00486	Trans_reg_C	0.51
PF02870	Methyltransf_1N	0.51
PF03640	Lipoprotein_15	0.51
PF01850	PIN	0.51
PF00067	p450	0.51
PF02445	NadA	0.51
PF01895	PhoU	0.51
PF00939	Na_sulph_symp	0.51

COG ID	Name	Functional Category	% Frequency in 195 Family Scaffolds
COG3797	Uncharacterized conserved protein, DUF1697 family	Function unknown [S]	7.18
COG1765	Uncharacterized OsmC-related protein	General function prediction only [R]	2.56
COG1764	Organic hydroperoxide reductase OsmC/OhrA	Defense mechanisms [V]	2.56
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.05
COG1635	Thiazole synthase/Archaeal ribulose 1,5-bisphosphate synthetase	Carbohydrate transport and metabolism [G]	2.05
COG0691	tmRNA-binding protein	Posttranslational modification, protein turnover, chaperones [O]	1.03
COG1230	Co/Zn/Cd efflux system component	Inorganic ion transport and metabolism [P]	0.51
COG4776	Exoribonuclease II	Transcription [K]	0.51
COG4315	Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)	Function unknown [S]	0.51
COG3965	Predicted Co/Zn/Cd cation transporter, cation efflux family	Inorganic ion transport and metabolism [P]	0.51
COG2124	Cytochrome P450	Defense mechanisms [V]	0.51
COG2086	Electron transfer flavoprotein, alpha and beta subunits	Energy production and conversion [C]	0.51
COG2025	Electron transfer flavoprotein, alpha subunit FixB	Energy production and conversion [C]	0.51
COG1893	Ketopantoate reductase	Coenzyme transport and metabolism [H]	0.51
COG1494	Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein	Carbohydrate transport and metabolism [G]	0.51
COG1430	Uncharacterized conserved membrane protein, UPF0127 family	Function unknown [S]	0.51
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	0.51
COG0053	Divalent metal cation (Fe/Co/Zn/Cd) efflux pump	Inorganic ion transport and metabolism [P]	0.51
COG1055	Na+/H+ antiporter NhaD or related arsenite permease	Inorganic ion transport and metabolism [P]	0.51
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.51
COG0793	C-terminal processing protease CtpA/Prc, contains a PDZ domain	Posttranslational modification, protein turnover, chaperones [O]	0.51
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.51
COG0557	Exoribonuclease R	Transcription [K]	0.51
COG0471	Di- and tricarboxylate antiporter	Carbohydrate transport and metabolism [G]	0.51
COG0379	Quinolinate synthase	Coenzyme transport and metabolism [H]	0.51
COG0350	DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)	Replication, recombination and repair [L]	0.51
COG0254	Ribosomal protein L31	Translation, ribosomal structure and biogenesis [J]	0.51
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.51
COG0174	Glutamine synthetase	Amino acid transport and metabolism [E]	0.51

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	80.00 %
Unclassified	root	N/A	20.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	80.00 %
Unclassified	root	N/A	20.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	80.00 %
Unclassified	root	N/A	20.00 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	67.69 %
Unclassified	root	N/A	20.00 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.54 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	64.62 %
Unclassified	root	N/A	20.00 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.03 %

Name	Rank	Taxonomy	Distribution
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	30.77 %
Unclassified	root	N/A	20.00 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	7.69 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.03 %

Name	Rank	Taxonomy	Distribution
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	27.18 %
Unclassified	root	N/A	20.00 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	1.54 %
Sterolibacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae	1.03 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	1.03 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.51 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.51 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.00 %
unclassified Solirubrobacterales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales	5.64 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	3.08 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.54 %
Methyloversatilis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis	1.03 %
Conexibacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae	1.03 %
Intrasporangiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae	1.03 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.51 %
Thermomonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae	0.51 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.00 %
Solirubrobacterales bacterium 70-9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	3.08 %
Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	2.56 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	1.54 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples	1.54 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.54 %
Pedococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus	1.03 %
unclassified Methyloversatilis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis	1.03 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	1.03 %
Actinomadura	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura	0.51 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.51 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.00 %
Solirubrobacterales bacterium 70-9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	3.08 %
Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	2.56 %
unclassified Solirubrobacter	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter	1.54 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	1.54 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.54 %
Methyloversatilis sp. RAC08	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. RAC08	1.03 %
Pedococcus cremeus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus → Pedococcus cremeus	1.03 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.03 %
Actinomadura madurae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae	0.51 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.51 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.00 %
Solirubrobacterales bacterium 70-9	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	3.08 %
Solirubrobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	2.56 %
Solirubrobacter sp. URHD0082	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082	1.54 %
uncultured Solirubrobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	1.54 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.54 %
Methyloversatilis sp. RAC08	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. RAC08	1.03 %
Pedococcus cremeus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus → Pedococcus cremeus	1.03 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.03 %
Actinomadura madurae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae	0.51 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.51 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.51 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908036\|A5_v_NODE_32832_len_553_cov_7_448463	Not Available	603	Open in IMG/M
3300000956\|JGI10216J12902_101819453	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	714	Open in IMG/M
3300001333\|A21PFW6_1018107	All Organisms → cellular organisms → Bacteria	6002	Open in IMG/M
3300001977\|JGI24746J21847_1013386	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1194	Open in IMG/M
3300002408\|B570J29032_108884395	Not Available	532	Open in IMG/M
3300002568\|C688J35102_119554444	Not Available	718	Open in IMG/M
3300003203\|JGI25406J46586_10060811	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	1220	Open in IMG/M
3300003418\|JGI26523J50269_1010362	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	2043	Open in IMG/M
3300003659\|JGI25404J52841_10001998	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3760	Open in IMG/M
3300003988\|Ga0055475_10092387	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	912	Open in IMG/M
3300004003\|Ga0055445_10283152	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	574	Open in IMG/M
3300004004\|Ga0055451_10149602	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	945	Open in IMG/M
3300004006\|Ga0055453_10021430	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1591	Open in IMG/M
3300004010\|Ga0055474_10014164	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2002	Open in IMG/M
3300004026\|Ga0055443_10225532	Not Available	593	Open in IMG/M
3300004065\|Ga0055481_10120169	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1113	Open in IMG/M
3300005183\|Ga0068993_10019559	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1694	Open in IMG/M
3300005337\|Ga0070682_100000045	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	131960	Open in IMG/M
3300005337\|Ga0070682_100177111	Not Available	1486	Open in IMG/M
3300005339\|Ga0070660_100456138	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1061	Open in IMG/M
3300005365\|Ga0070688_100000630	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	17586	Open in IMG/M
3300005365\|Ga0070688_100345487	All Organisms → cellular organisms → Bacteria	1088	Open in IMG/M
3300005366\|Ga0070659_100001961	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	14692	Open in IMG/M
3300005441\|Ga0070700_100089312	All Organisms → cellular organisms → Bacteria	2008	Open in IMG/M
3300005447\|Ga0066689_10230248	Not Available	1134	Open in IMG/M
3300005455\|Ga0070663_101503810	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	598	Open in IMG/M
3300005466\|Ga0070685_10405637	All Organisms → cellular organisms → Bacteria	945	Open in IMG/M
3300005563\|Ga0068855_102613087	Not Available	501	Open in IMG/M
3300005576\|Ga0066708_10638584	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	679	Open in IMG/M
3300005578\|Ga0068854_100345861	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1216	Open in IMG/M
3300005614\|Ga0068856_100001194	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	27371	Open in IMG/M
3300005718\|Ga0068866_10000001	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	519680	Open in IMG/M
3300005840\|Ga0068870_10604507	All Organisms → cellular organisms → Bacteria → Terrabacteria group	745	Open in IMG/M
3300006042\|Ga0075368_10539504	Not Available	523	Open in IMG/M
3300006046\|Ga0066652_100144349	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1987	Open in IMG/M
3300006237\|Ga0097621_101476667	Not Available	645	Open in IMG/M
3300006575\|Ga0074053_11877087	All Organisms → cellular organisms → Bacteria	1146	Open in IMG/M
3300006576\|Ga0074047_11972893	Not Available	514	Open in IMG/M
3300006606\|Ga0074062_12627354	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1705	Open in IMG/M
3300006640\|Ga0075527_10014248	Not Available	2043	Open in IMG/M
3300006755\|Ga0079222_10141190	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1351	Open in IMG/M
3300006796\|Ga0066665_11135343	Not Available	595	Open in IMG/M
3300006806\|Ga0079220_11810796	Not Available	538	Open in IMG/M
3300006853\|Ga0075420_100183171	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1832	Open in IMG/M
3300006881\|Ga0068865_100000104	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	43423	Open in IMG/M
3300006881\|Ga0068865_100126446	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1909	Open in IMG/M
3300006904\|Ga0075424_101479355	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	721	Open in IMG/M
3300006954\|Ga0079219_11749153	Not Available	579	Open in IMG/M
3300007769\|Ga0102952_1058880	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1157	Open in IMG/M
3300009098\|Ga0105245_10000016	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	204372	Open in IMG/M
3300009101\|Ga0105247_10009385	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	5941	Open in IMG/M
3300009112\|Ga0115923_10236424	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1860	Open in IMG/M
3300009148\|Ga0105243_11593734	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	679	Open in IMG/M
3300009156\|Ga0111538_11819721	All Organisms → cellular organisms → Bacteria → Terrabacteria group	766	Open in IMG/M
3300009840\|Ga0126313_10441810	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	1036	Open in IMG/M
3300010045\|Ga0126311_10910233	All Organisms → cellular organisms → Bacteria → Terrabacteria group	715	Open in IMG/M
3300010051\|Ga0133939_1111441	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1570	Open in IMG/M
3300010166\|Ga0126306_10077699	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2358	Open in IMG/M
3300010359\|Ga0126376_11156566	Not Available	786	Open in IMG/M
3300010362\|Ga0126377_10702808	Not Available	1064	Open in IMG/M
3300010375\|Ga0105239_10227514	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2092	Open in IMG/M
3300010397\|Ga0134124_11344304	All Organisms → cellular organisms → Bacteria	739	Open in IMG/M
3300010400\|Ga0134122_10060775	All Organisms → cellular organisms → Bacteria	2918	Open in IMG/M
3300010400\|Ga0134122_11453290	All Organisms → cellular organisms → Bacteria → Terrabacteria group	702	Open in IMG/M
3300010403\|Ga0134123_12044559	All Organisms → cellular organisms → Bacteria → Terrabacteria group	632	Open in IMG/M
3300011107\|Ga0151490_1330005	Not Available	502	Open in IMG/M
3300011418\|Ga0153954_1009011	All Organisms → cellular organisms → Bacteria	3050	Open in IMG/M
3300012912\|Ga0157306_10002201	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3613	Open in IMG/M
3300012915\|Ga0157302_10000003	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	168510	Open in IMG/M
3300012924\|Ga0137413_10251248	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1214	Open in IMG/M
3300012939\|Ga0162650_100001716	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2154	Open in IMG/M
3300012958\|Ga0164299_10000007	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	126092	Open in IMG/M
3300012984\|Ga0164309_10861090	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	735	Open in IMG/M
3300012985\|Ga0164308_10013850	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082	4500	Open in IMG/M
3300012987\|Ga0164307_11742222	Not Available	528	Open in IMG/M
3300012988\|Ga0164306_10004359	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	6778	Open in IMG/M
3300013102\|Ga0157371_10015152	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	5791	Open in IMG/M
3300013104\|Ga0157370_10046026	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4184	Open in IMG/M
3300013104\|Ga0157370_10051847	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3918	Open in IMG/M
3300013105\|Ga0157369_10000110	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	115514	Open in IMG/M
3300013105\|Ga0157369_11343769	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus → Pedococcus cremeus	728	Open in IMG/M
3300013296\|Ga0157374_10034901	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4599	Open in IMG/M
3300013306\|Ga0163162_10651873	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1176	Open in IMG/M
3300013308\|Ga0157375_10026721	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082	5385	Open in IMG/M
3300013503\|Ga0120127_10000100	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	22685	Open in IMG/M
3300014265\|Ga0075314_1001076	All Organisms → cellular organisms → Bacteria → Terrabacteria group	4969	Open in IMG/M
3300014267\|Ga0075313_1014444	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	1781	Open in IMG/M
3300014301\|Ga0075323_1000920	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082	3769	Open in IMG/M
3300014310\|Ga0075331_1068615	All Organisms → cellular organisms → Bacteria → Proteobacteria	806	Open in IMG/M
3300014325\|Ga0163163_10400726	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1430	Open in IMG/M
3300014326\|Ga0157380_10000815	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	19534	Open in IMG/M
3300014326\|Ga0157380_11537940	Not Available	719	Open in IMG/M
3300014487\|Ga0182000_10252739	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	708	Open in IMG/M
3300014827\|Ga0120171_1152424	Not Available	528	Open in IMG/M
3300015089\|Ga0167643_1018892	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	1048	Open in IMG/M
3300015090\|Ga0167634_1016618	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1048	Open in IMG/M
3300015371\|Ga0132258_11204640	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1914	Open in IMG/M
3300018027\|Ga0184605_10297219	Not Available	732	Open in IMG/M
3300018061\|Ga0184619_10027827	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2363	Open in IMG/M
3300018066\|Ga0184617_1277688	Not Available	504	Open in IMG/M
3300018422\|Ga0190265_10000299	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	39882	Open in IMG/M
3300018422\|Ga0190265_10017886	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	5573	Open in IMG/M
3300018422\|Ga0190265_10136877	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2370	Open in IMG/M
3300018422\|Ga0190265_10668738	Not Available	1159	Open in IMG/M
3300018422\|Ga0190265_10686569	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1145	Open in IMG/M
3300018429\|Ga0190272_10000206	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	36212	Open in IMG/M
3300018429\|Ga0190272_10000535	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	19632	Open in IMG/M
3300018432\|Ga0190275_10497714	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1252	Open in IMG/M
3300018432\|Ga0190275_13252213	Not Available	526	Open in IMG/M
3300018469\|Ga0190270_11793800	All Organisms → cellular organisms → Bacteria	669	Open in IMG/M
3300018476\|Ga0190274_10372894	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1369	Open in IMG/M
3300018476\|Ga0190274_11415226	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	785	Open in IMG/M
3300018481\|Ga0190271_10003147	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	10268	Open in IMG/M
3300018920\|Ga0190273_10000677	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	12408	Open in IMG/M
3300018920\|Ga0190273_10145517	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1407	Open in IMG/M
3300019889\|Ga0193743_1061721	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	1560	Open in IMG/M
3300020002\|Ga0193730_1009615	All Organisms → cellular organisms → Bacteria	2725	Open in IMG/M
3300020016\|Ga0193696_1017635	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1924	Open in IMG/M
3300020020\|Ga0193738_1147376	Not Available	633	Open in IMG/M
3300020021\|Ga0193726_1011771	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4674	Open in IMG/M
3300020021\|Ga0193726_1317033	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	594	Open in IMG/M
3300020082\|Ga0206353_10759580	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1208	Open in IMG/M
3300021339\|Ga0193706_1078498	All Organisms → cellular organisms → Bacteria	902	Open in IMG/M
3300021339\|Ga0193706_1126276	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	696	Open in IMG/M
3300021344\|Ga0193719_10151356	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1001	Open in IMG/M
3300021510\|Ga0222621_1053559	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. RAC08	846	Open in IMG/M
3300022899\|Ga0247795_1000394	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	7246	Open in IMG/M
3300023102\|Ga0247754_1000337	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	6768	Open in IMG/M
3300024981\|Ga0209934_1015471	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1831	Open in IMG/M
3300025321\|Ga0207656_10000116	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	30697	Open in IMG/M
3300025556\|Ga0210120_1006128	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2500	Open in IMG/M
3300025565\|Ga0210110_1000003	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	132808	Open in IMG/M
3300025565\|Ga0210110_1003169	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	4681	Open in IMG/M
3300025565\|Ga0210110_1021418	Not Available	1668	Open in IMG/M
3300025583\|Ga0210085_1000521	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	16078	Open in IMG/M
3300025780\|Ga0210100_1055858	Not Available	566	Open in IMG/M
3300025798\|Ga0210063_1000006	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	216102	Open in IMG/M
3300025799\|Ga0210122_1054420	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	917	Open in IMG/M
3300025814\|Ga0210101_1000102	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	29431	Open in IMG/M
3300025817\|Ga0210144_1021532	Not Available	2085	Open in IMG/M
3300025899\|Ga0207642_10000031	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	45198	Open in IMG/M
3300025899\|Ga0207642_10794175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. RAC08	602	Open in IMG/M
3300025900\|Ga0207710_10000158	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	72527	Open in IMG/M
3300025908\|Ga0207643_10334278	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	948	Open in IMG/M
3300025915\|Ga0207693_10199525	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1573	Open in IMG/M
3300025916\|Ga0207663_10072667	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2224	Open in IMG/M
3300025927\|Ga0207687_10000018	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	236159	Open in IMG/M
3300025932\|Ga0207690_10001068	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	17537	Open in IMG/M
3300025936\|Ga0207670_10089563	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	2172	Open in IMG/M
3300025938\|Ga0207704_10000146	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	37894	Open in IMG/M
3300025942\|Ga0207689_11814178	Not Available	503	Open in IMG/M
3300025953\|Ga0210068_1000108	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	12682	Open in IMG/M
3300026045\|Ga0208535_1000608	All Organisms → cellular organisms → Bacteria	4100	Open in IMG/M
3300026058\|Ga0208421_1001069	All Organisms → cellular organisms → Bacteria	1946	Open in IMG/M
3300026067\|Ga0207678_11659051	Not Available	562	Open in IMG/M
3300026075\|Ga0207708_10259670	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium	1402	Open in IMG/M
3300026078\|Ga0207702_10000607	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	39638	Open in IMG/M
3300026089\|Ga0207648_10000848	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	34516	Open in IMG/M
3300026116\|Ga0207674_10454584	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus → Pedococcus cremeus	1238	Open in IMG/M
3300026127\|Ga0209956_1009152	All Organisms → cellular organisms → Bacteria	2012	Open in IMG/M
3300027257\|Ga0208996_1006499	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1365	Open in IMG/M
3300027761\|Ga0209462_10000037	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	11818	Open in IMG/M
3300028420\|Ga0210366_10003989	All Organisms → cellular organisms → Bacteria	3676	Open in IMG/M
3300028589\|Ga0247818_10906901	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	620	Open in IMG/M
3300028707\|Ga0307291_1004786	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2891	Open in IMG/M
3300028713\|Ga0307303_10174819	Not Available	524	Open in IMG/M
3300028721\|Ga0307315_10002582	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4376	Open in IMG/M
3300028722\|Ga0307319_10000002	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	329528	Open in IMG/M
3300028754\|Ga0307297_10145315	Not Available	806	Open in IMG/M
3300028768\|Ga0307280_10186762	Not Available	728	Open in IMG/M
3300028778\|Ga0307288_10065072	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1280	Open in IMG/M
3300028784\|Ga0307282_10044997	All Organisms → cellular organisms → Bacteria	1955	Open in IMG/M
3300028784\|Ga0307282_10317372	Not Available	752	Open in IMG/M
3300028784\|Ga0307282_10471275	All Organisms → cellular organisms → Bacteria	609	Open in IMG/M
3300028800\|Ga0265338_11121297	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	529	Open in IMG/M
3300028802\|Ga0307503_10853957	Not Available	523	Open in IMG/M
3300028872\|Ga0307314_10006693	All Organisms → cellular organisms → Bacteria	2426	Open in IMG/M
3300028875\|Ga0307289_10231494	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	760	Open in IMG/M
3300029943\|Ga0311340_11357344	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300030521\|Ga0307511_10063286	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2796	Open in IMG/M
3300031184\|Ga0307499_10002029	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5322	Open in IMG/M
3300031200\|Ga0307496_10003985	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9	1639	Open in IMG/M
3300031228\|Ga0299914_10000005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	187644	Open in IMG/M
3300031228\|Ga0299914_11298439	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	577	Open in IMG/M
3300031228\|Ga0299914_11312815	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	573	Open in IMG/M
3300031229\|Ga0299913_10064300	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3529	Open in IMG/M
3300031873\|Ga0315297_10084478	Not Available	2488	Open in IMG/M
3300032133\|Ga0316583_10016862	All Organisms → cellular organisms → Bacteria	2627	Open in IMG/M
3300032174\|Ga0307470_10008393	All Organisms → cellular organisms → Bacteria	4170	Open in IMG/M
3300032205\|Ga0307472_100089516	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2078	Open in IMG/M
3300032770\|Ga0335085_10018940	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	9870	Open in IMG/M
3300034687\|Ga0334905_002025	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae	2914	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	71.28%
Host-Associated	Host-Associated	26.67%
Engineered	Engineered	2.05%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	56.92%
Plants	Host-Associated → Plants	26.15%
Aquatic	Environmental → Aquatic	14.36%
Bioremediation	Engineered → Bioremediation	1.03%
Fungi	Host-Associated → Fungi	0.51%
Wastewater	Engineered → Wastewater	0.51%
Built Environment	Engineered → Built Environment	0.51%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	55.90%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.82%
Marine	Environmental → Aquatic → Marine	10.77%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.77%
Sediment	Environmental → Aquatic → Sediment	2.05%
Roots	Host-Associated → Plants → Roots	2.05%
Freshwater	Environmental → Aquatic → Freshwater	1.54%
Hydrocarbon	Engineered → Bioremediation → Hydrocarbon	1.03%
Peat	Environmental → Terrestrial → Peat	0.51%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.51%
Phyllosphere	Host-Associated → Plants → Phyllosphere	0.51%
Mycelium	Host-Associated → Fungi → Mycelium	0.51%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.51%
Unclassified	Engineered → Built Environment → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	45.13%
Wetlands	Environmental → Aquatic → Marine → Wetlands	10.26%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.26%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.74%
Loam	Environmental → Terrestrial → Soil → Loam	6.15%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.62%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.08%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.05%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.03%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.03%
Unclassified	Engineered → Bioremediation → Hydrocarbon → Unclassified	1.03%
Lake	Environmental → Aquatic → Freshwater → Lake	0.51%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.51%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.51%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.51%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.51%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.51%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.51%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	0.51%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.51%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.51%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	33.33%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	10.26%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.26%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.74%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.13%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.62%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.08%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.56%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	2.56%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.56%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.05%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	2.05%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	1.03%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.03%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.03%
Unclassified	Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified	1.03%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.51%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.51%
Desert	Environmental → Terrestrial → Soil → Unclassified → Desert	0.51%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.51%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.51%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.51%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.51%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.51%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.51%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.51%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.51%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	0.51%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.51%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.51%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	23.59%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	10.26%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.13%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	3.08%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.08%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.56%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.05%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	2.05%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.05%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.05%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.54%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.54%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.54%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	1.54%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.54%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.03%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.03%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.03%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.03%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.03%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.03%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.03%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.03%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.03%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.03%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.03%
Wastewater Bioreactor	Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor	1.03%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.51%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.51%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.51%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.51%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.51%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.51%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Desert → Soil	0.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.51%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.51%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.51%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.51%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.51%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.51%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.51%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.51%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.51%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.51%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.51%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.51%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	0.51%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.51%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.51%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.51%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	0.51%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.51%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater	0.51%
Swimming Pool Sandfilter Backwash	Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash	0.51%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908036	Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001333	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina	Environmental	Open in IMG/M
3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Host-Associated	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300003418	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_biof	Engineered	Open in IMG/M
3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300003988	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2	Environmental	Open in IMG/M
3300003990	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2	Environmental	Open in IMG/M
3300004003	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1	Environmental	Open in IMG/M
3300004004	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2	Environmental	Open in IMG/M
3300004006	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2	Environmental	Open in IMG/M
3300004010	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D1	Environmental	Open in IMG/M
3300004026	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2	Environmental	Open in IMG/M
3300004065	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2	Environmental	Open in IMG/M
3300005183	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005447	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006042	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006575	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006576	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006640	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007769	Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009112	Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2	Engineered	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010051	Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196	Engineered	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011107	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300011418	Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG	Host-Associated	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012939	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300013503	Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M	Environmental	Open in IMG/M
3300014265	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2	Environmental	Open in IMG/M
3300014267	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1	Environmental	Open in IMG/M
3300014301	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1	Environmental	Open in IMG/M
3300014310	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014487	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG	Environmental	Open in IMG/M
3300014827	Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M	Environmental	Open in IMG/M
3300015089	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))	Environmental	Open in IMG/M
3300015090	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019889	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2	Environmental	Open in IMG/M
3300020002	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1	Environmental	Open in IMG/M
3300020016	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1	Environmental	Open in IMG/M
3300020020	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1	Environmental	Open in IMG/M
3300020021	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1	Environmental	Open in IMG/M
3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300021339	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300021510	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex	Environmental	Open in IMG/M
3300022899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6	Environmental	Open in IMG/M
3300023102	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5	Environmental	Open in IMG/M
3300024981	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_plan (SPAdes)	Engineered	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025556	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025565	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes)	Environmental	Open in IMG/M
3300025583	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes)	Environmental	Open in IMG/M
3300025780	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes)	Environmental	Open in IMG/M
3300025798	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D1 (SPAdes)	Environmental	Open in IMG/M
3300025799	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025814	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes)	Environmental	Open in IMG/M
3300025817	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025953	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes)	Environmental	Open in IMG/M
3300026045	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes)	Environmental	Open in IMG/M
3300026058	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes)	Environmental	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026127	Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG (SPAdes)	Environmental	Open in IMG/M
3300027257	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes)	Environmental	Open in IMG/M
3300027761	Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes)	Host-Associated	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300028420	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028589	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1	Environmental	Open in IMG/M
3300028707	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148	Environmental	Open in IMG/M
3300028713	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184	Environmental	Open in IMG/M
3300028721	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355	Environmental	Open in IMG/M
3300028722	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368	Environmental	Open in IMG/M
3300028754	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157	Environmental	Open in IMG/M
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental	Open in IMG/M
3300028778	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Host-Associated	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300028872	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204	Environmental	Open in IMG/M
3300028875	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143	Environmental	Open in IMG/M
3300029943	I_Palsa_N3 coassembly	Environmental	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental	Open in IMG/M
3300031200	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S	Environmental	Open in IMG/M
3300031228	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57	Environmental	Open in IMG/M
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Host-Associated	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300034687	Soil microbial communities from Mojave Desert, California, United States - 1NOC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.16
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.16
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F027211

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
A5_v_00034170	2124908036	Soil	MVRTYWFFPGFYEASGNLGLQPFARIDCVEACRPRAMYGPILPAVNRRPKK
JGI10216J12902_1018194531	3300000956	Soil	GEGELMVRTLFFPVFNEASGNLGLQPFARIDHVEA*
A21PFW6_10181073	3300001333	Permafrost	MVRTYWLVPGFNEASGNLDLRPFARIDQIEACRPRAMCPPIVR*
JGI24746J21847_10133864	3300001977	Corn, Switchgrass And Miscanthus Rhizosphere	MVRTYWLVPVFYEASGNLDLQPFARTDQVEACRPRAMCIPLYALG*
B570J29032_1088843952	3300002408	Freshwater	MVRTYWFLPIFYEAIDILDLQPSARTDLVEACRPRR*
C688J35102_1195544442	3300002568	Soil	MVRTYWFLPVFYEASGHLDLQPFARTDHVEACRPRAMCLQLYGVVLGPE*
JGI25406J46586_100608112	3300003203	Tabebuia Heterophylla Rhizosphere	MVRTYWFVSGFNEASDNLDLQPFARIDHVEACRPRANFA*
JGI26523J50269_10103622	3300003418	Wastewater Bioreactor	MVRTYWFVPIFYEAIDILDLQPSARSDNVEACRPLGWCTTIVR*
JGI25404J52841_100019986	3300003659	Tabebuia Heterophylla Rhizosphere	MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAGCI*
Ga0055475_100923871	3300003988	Natural And Restored Wetlands	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMCNR
Ga0055455_100179741	3300003990	Natural And Restored Wetlands	MVRTYWLVPVFYEASGNLDLRPFARTDQIGLSPPCYVLSIVRGPVG*
Ga0055445_102831522	3300004003	Natural And Restored Wetlands	MVRTYWFVPVFYEASGNLDLQPFARVDHVEACRPRALLISIVGRTGRMGL*
Ga0055451_101496021	3300004004	Natural And Restored Wetlands	VRTYWLVPVFNEASGHLDLQPFARIDQVEACRPRAMWLPIVRCRA*
Ga0055453_100214302	3300004006	Natural And Restored Wetlands	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMCSRLYGVRSGRLEA*
Ga0055474_100141642	3300004010	Natural And Restored Wetlands	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPHAMCIRLYAAG*
Ga0055443_102255322	3300004026	Natural And Restored Wetlands	MVRTSWLVPGFYEASGNLDLQSNARDNHVEAWRPRAMSDY
Ga0055481_101201692	3300004065	Natural And Restored Wetlands	EGELMVRTYWLVPVFNEASGHLDLQPFARTDQVEACRPRAMWLPIVRCRA*
Ga0068993_100195595	3300005183	Natural And Restored Wetlands	MVRTYWLLPVFYEASGHLDLQPFARTDRVEACRPRAMCSRLYGP
Ga0070682_10000004550	3300005337	Corn Rhizosphere	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRAWDTH*
Ga0070682_1001771111	3300005337	Corn Rhizosphere	MVRTYWFVPGFNEASDNLDLQPFARVDHVEACRPRTLRFEL*
Ga0070660_1004561381	3300005339	Corn Rhizosphere	LSGEGELMVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAWIRI*
Ga0070688_10000063020	3300005365	Switchgrass Rhizosphere	GELMVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDALGL*
Ga0070688_1003454872	3300005365	Switchgrass Rhizosphere	MVRTYWLLPVFNEASGHLDLQPFARIDRVEACRPRAMCFQLYGVA*
Ga0070659_1000019613	3300005366	Corn Rhizosphere	MVRTYWFVTGFNEASVNLDLQPFARIDHVEACRPRAWIRI*
Ga0070700_1000893124	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MVRTYWFVSGFNEASDNLDLQPFARVDHVEACRPRALRFEF*
Ga0066689_102302482	3300005447	Soil	MVRTYWFFPVFSEASGNLGLQPSARIDQIEACRPRAMSW*
Ga0070663_1015038101	3300005455	Corn Rhizosphere	SEGELMVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPRAMWHRLYGAG*
Ga0070685_104056372	3300005466	Switchgrass Rhizosphere	MVRTYWLLPVFNEASGHLDLQPFARIDRVEACRPRAMCLELYGVA*
Ga0068855_1026130871	3300005563	Corn Rhizosphere	MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRA
Ga0066708_106385842	3300005576	Soil	GEGELMVRTYWFFPVFSEASGNLGLQPSARIDQIEACRPRAMWW*
Ga0068854_1003458612	3300005578	Corn Rhizosphere	MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMSLRLYGVG*
Ga0068856_1000011941	3300005614	Corn Rhizosphere	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAPPF*
Ga0068866_10000001241	3300005718	Miscanthus Rhizosphere	MVRTYWLVPVFNEASGHLDLQPFARTDHVEACRPRAM*
Ga0068870_106045072	3300005840	Miscanthus Rhizosphere	MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRA
Ga0075368_105395041	3300006042	Populus Endosphere	VVRSSWFFLVFYEASRNLDLQSVARNNHVEACRPR
Ga0066652_1001443493	3300006046	Soil	MVRTYWFFPVFNEASGNLGLQPFARIDHVEACRPRAMSLPIG*
Ga0097621_1014766672	3300006237	Miscanthus Rhizosphere	MVRTYWFVSGFNEASDNLDLQPFARIDHVEACRPR
Ga0074053_118770872	3300006575	Soil	MVRTYWLVPVFNEASGHLGLQPFARTDQVEACRPRAMWPLIVR*
Ga0074047_119728931	3300006576	Soil	MVRTYWFVSGFNEASDNLDLQPFARVDHVEACRPR
Ga0074062_126273543	3300006606	Soil	MVRTYWLVPVFNEASDHLDLQPFARIDRVEACRPRAMCS*
Ga0075527_100142482	3300006640	Arctic Peat Soil	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMCIRLYAGG*
Ga0079222_101411902	3300006755	Agricultural Soil	MVRTYWLVPVFYEASGHLDLRPFARTDRVEACRPRAM*
Ga0066665_111353432	3300006796	Soil	MVRTYWFFPVFSEASGNLGLQPSAWIDQIEACRPRAMWW*
Ga0079220_118107961	3300006806	Agricultural Soil	MVRTYWLVPVFNEASDNLGLQPFARIDHVEACRPRAMCAV
Ga0075420_1001831714	3300006853	Populus Rhizosphere	LPVFYEASGNLDLQPFARVDHVETCRPRAMYAPEDTR
Ga0068865_10000010417	3300006881	Miscanthus Rhizosphere	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAW*
Ga0068865_1001264464	3300006881	Miscanthus Rhizosphere	MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPR
Ga0075424_1014793552	3300006904	Populus Rhizosphere	YWLVPVFNEASGNLGLQPFARIDQIEACRPRAMSL*
Ga0079219_117491531	3300006954	Agricultural Soil	MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRAWNA
Ga0102952_10588802	3300007769	Soil	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMWLPIVRGQVG*
Ga0105245_10000016129	3300009098	Miscanthus Rhizosphere	MVRTYWLVPVFNEASGNLDLQPFARTDHVEACRPRAMCTKCT*
Ga0105247_100093857	3300009101	Switchgrass Rhizosphere	MVRTYWLVPVFYEASGNLDLQPFARVDHVEACRPRAMCIRLYGAG*
Ga0115923_102364243	3300009112	Swimming Pool Sandfilter Backwash	MVRTYWFVSGFNEASDNLDLQPFARIDHVEACRPRAHFA*
Ga0105243_115937342	3300009148	Miscanthus Rhizosphere	MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRATAHRLYGVG*
Ga0111538_118197212	3300009156	Populus Rhizosphere	MVRTYWFLPGFNEASGNLDLQPFARVDHVETCRPRAMYAPED
Ga0126313_104418102	3300009840	Serpentine Soil	MVRTYWLVSGFNEASDNLDLQPFARVDHVEACRPRALRFQL*
Ga0126311_109102332	3300010045	Serpentine Soil	MVRTYWCVLGFNEASSNLDLQPCARVDHVEACRPRAWECLP
Ga0133939_11114411	3300010051	Industrial Wastewater	MVRTYWLVPVFYEASGNLGLQPFARCDHVEACRPRAMY
Ga0126306_100776992	3300010166	Serpentine Soil	MVRTYWFVPGFNEASDNLDLQPFARVDHVEACRPRALPFEF*
Ga0126376_111565661	3300010359	Tropical Forest Soil	MVRTYWLLPVFYEASGHLDLQPFARTDHVEACRPRAMCLQLYGV
Ga0126377_107028081	3300010362	Tropical Forest Soil	MVRTYWFVPGFNEASGNLDLQPFARVDHVEACRPRACCASN
Ga0105239_102275141	3300010375	Corn Rhizosphere	EGELMVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDALRL*
Ga0134124_113443042	3300010397	Terrestrial Soil	MVRTYWFVPGFNEASGNLDLQPFARVDHVEACRPRAC
Ga0134122_100607752	3300010400	Terrestrial Soil	MVRTYWFLPGFNEASGNLDLQPFARTDHVEACRPRAM*
Ga0134122_114532901	3300010400	Terrestrial Soil	MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPHARCTSIVR
Ga0134123_120445591	3300010403	Terrestrial Soil	MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAM
Ga0151490_13300052	3300011107	Soil	MVRTYWFLPGVNEAACNLDLQPFARTDHVEACRPRAMCRA
Ga0153954_10090113	3300011418	Attine Ant Fungus Gardens	MVRTYWFVSGFNEASDNLDLQPFARIDHVEACRPRAWCI*
Ga0137370_103734822	3300012285	Vadose Zone Soil	MVRTYWFFPVFYEASGNLDLQPFARIDQIDACRPRAMSWQRFYRSGYI*
Ga0157306_100022013	3300012912	Soil	MVRTYWLVPVFYEASGNLDLQPFARTDHVEACRPRAMS*
Ga0157302_1000000341	3300012915	Soil	MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRAAAHRLYGVG*
Ga0137413_102512481	3300012924	Vadose Zone Soil	MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRA
Ga0162650_1000017165	3300012939	Soil	MVRTYWLVPGFNEAAGNLDLQPSARIDHVEACRPRALCIRLYFAG*
Ga0164299_10000007101	3300012958	Soil	MVRTYWLVPVFNEASGNLVLRPFARIDQIEACRPRAMWLPIVR*
Ga0164309_108610901	3300012984	Soil	MVRTYWLVPVFNEASGNLDLQPFARIDHVEACRPRAM
Ga0164308_100138503	3300012985	Soil	MVRTYWLVPVFNEASGNLDLRPFARIDQIEACRPRAMWLPIVR*
Ga0164307_117422222	3300012987	Soil	MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMCPQLYGVVLGTR*
Ga0164306_100043592	3300012988	Soil	MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRAAAHRLYVVG*
Ga0157371_100151526	3300013102	Corn Rhizosphere	MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRACDAL*
Ga0157370_100460265	3300013104	Corn Rhizosphere	MVRTYWLVPGFNEASGNLDLRPFARIDQIEACRPRAM*
Ga0157370_100518471	3300013104	Corn Rhizosphere	MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRAW
Ga0157369_100001103	3300013105	Corn Rhizosphere	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAL*
Ga0157369_113437692	3300013105	Corn Rhizosphere	MVRTYWLVPVFHEASGHLDLQPFARTDQVEACRPRAMSHSIVRCP
Ga0157374_100349015	3300013296	Miscanthus Rhizosphere	MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRALRHRLYGVG*
Ga0163162_106518732	3300013306	Switchgrass Rhizosphere	MVRTYWFVPGFNEASDNLDLQPFARVDHVEACRPRALRFEL*
Ga0157375_100267215	3300013308	Miscanthus Rhizosphere	MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRALQHRLYGVG*
Ga0120127_1000010023	3300013503	Permafrost	MVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPRAM*
Ga0075314_10010763	3300014265	Natural And Restored Wetlands	MVRTYWLVPVFYEASGHLDLQPFARTDHVEACRPRAM*
Ga0075313_10144443	3300014267	Natural And Restored Wetlands	EGELMVRTYWLVPVFNEASGHLDLQPFARTDRIEACRPRAMSHTIVR*
Ga0075323_10009206	3300014301	Natural And Restored Wetlands	MVRTYWLVPVFYEASGNLDLQPFARTDQIEACRPRAMWLPSVRRRVGWGK*
Ga0075331_10686152	3300014310	Natural And Restored Wetlands	MVRTYWLVPVFNEASGHLGLQPFARISQVEACRPRAMCIQLYGSERE*
Ga0163163_104007262	3300014325	Switchgrass Rhizosphere	MVRTYWLLPVFNEASGHLDLQPFARTDYVEACRPRAMCLQLYGVA*
Ga0157380_100008157	3300014326	Switchgrass Rhizosphere	MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAM*
Ga0157380_115379401	3300014326	Switchgrass Rhizosphere	MVRTYWLVPVFNEASGNLDLQPFARIDHVEACRPRAMCPQL*
Ga0182000_102527392	3300014487	Soil	EGELMVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDA*
Ga0120171_11524241	3300014827	Permafrost	MVRTYWFFPGFYEASGNLDLQPFARIDRVEACRPRAMC
Ga0167643_10188922	3300015089	Glacier Forefield Soil	MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAGCIWE
Ga0167634_10166181	3300015090	Glacier Forefield Soil	MVRTYWLVPGFNEASDNLDLQPFARIDQIEACRPRAMWHRLYGAG*
Ga0132258_112046401	3300015371	Arabidopsis Rhizosphere	GELMVRTYWFLPGFNEASGNLDLQPFARTDHVEACRPRAM*
Ga0184605_102972192	3300018027	Groundwater Sediment	MVRTYWFFPGFYEASGNLDLQPFARIDCVEACRPRAMYALILRRERH
Ga0184619_100278272	3300018061	Groundwater Sediment	MVRTYWFFPVFSEASGNLGLQPSARIDQIEACRPRALS
Ga0184617_12776881	3300018066	Groundwater Sediment	MVRTYWFFPVFHEASGNLGLQPFARIDHVEACRPRAMCRRFYRRR
Ga0190265_1000029916	3300018422	Soil	MVRTYWLVPVFYEASGNLDLQPFARIDYVEACRPRAMCS
Ga0190265_100178861	3300018422	Soil	MVRTYWLVPVFNEASGNLDLQPFARIDQIEACRPRAMCVRLYAAVDA
Ga0190265_101368771	3300018422	Soil	MVRTYWLVPGFNEASGNLGLQPVARIGQVEACHPRAMS
Ga0190265_106687382	3300018422	Soil	GELMVRTYWLVPGFNEASGNLGLQPVARIGQVEACHPRAMSVPLRLYGVG
Ga0190265_106865692	3300018422	Soil	LSGEGELMVRTYWLVPVFYEASGNLDLQPFARIDYVEACRPRAMCF
Ga0190272_1000020632	3300018429	Soil	MVRTYWLVPGFNEASGNLGLQPVARIGQVEACHPRAMSVPLRLYGVG
Ga0190272_100005358	3300018429	Soil	MVRTYWLVPGFNEASGNLDLQPFARIDHVEACRPRALRIPLYGAG
Ga0190275_104977142	3300018432	Soil	VRTYWFVSGFNEASDNLDLQPFARVDHVEACRPRALRFEL
Ga0190275_132522131	3300018432	Soil	MVRNSWFFPVFYEASGNLDLQPNARDNRVEACRPRAMC
Ga0190270_117938002	3300018469	Soil	MVRNYGFLPVFNEASGNLGLQPYARIDHVEACRPP
Ga0190274_103728941	3300018476	Soil	MVRTYWLVPVFYEASGNLDLQPFARIDQIEACRPRAMSAPIVR
Ga0190274_114152262	3300018476	Soil	LVPGFNEASGNLDLQPFARVDHVEACRPRALRFEL
Ga0190271_100031478	3300018481	Soil	MVRTYWLVPVFNEASGNLDLQPFARVDHVEACRPRAMRIQLYAAG
Ga0190273_100006778	3300018920	Soil	MVRTYWFVTGFNEASVNLDLQPFTRVDHVEACRPRACAA
Ga0190273_101455172	3300018920	Soil	MVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPRAM
Ga0193743_10617211	3300019889	Soil	MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAG
Ga0193730_10096152	3300020002	Soil	MVRTYWFFPGFYEASGNLDLQPFARIDCVEACRPRAM
Ga0193696_10176352	3300020016	Soil	MVRTYWLVPVFNEASGNLDLQPFARIDQIEACRPRAMSASIVRCRVAMAK
Ga0193738_11473761	3300020020	Soil	MVRTYWFVLGFNEASSNLDLQPFTRVDHVEACRPRAWE
Ga0193726_10117715	3300020021	Soil	MVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPRAMWHRLYGAG
Ga0193726_13170332	3300020021	Soil	DRLLRLSYELSGKGELMVRTYWFVSGFNEASDNLDLQPFARNDHVEACRPRTRCI
Ga0206353_107595801	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRAWDTH
Ga0193706_10784982	3300021339	Soil	MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRALQHRLYGVG
Ga0193706_11262761	3300021339	Soil	LSGEGELMVRTYWLVPGFNEASGNLDLQPSARIDHVEACRPRALRIPLYGAG
Ga0193719_101513562	3300021344	Soil	MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMSCLTRLYGVA
Ga0222621_10535591	3300021510	Groundwater Sediment	MVRTYWLVPVFNEASDHLDLQPFARTDRVEACRPRAMCF
Ga0247795_10003944	3300022899	Soil	MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRAWNAH
Ga0247754_10003374	3300023102	Soil	MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMCIRLYGVG
Ga0209934_10154711	3300024981	Wastewater Bioreactor	MVRTYWFVPIFYEAIDILDLQPSARSDNVEACRPLGWCTTIVR
Ga0207656_1000011627	3300025321	Corn Rhizosphere	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRAWDTH
Ga0210120_10061283	3300025556	Natural And Restored Wetlands	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMCSRLYGVRSGRLEA
Ga0210110_100000337	3300025565	Natural And Restored Wetlands	MVRTYWLVPVFYEASGHLDLRPFARTDQIEACRPRAMWLPIVRGRVG
Ga0210110_10031693	3300025565	Natural And Restored Wetlands	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMWLPIVRGRVG
Ga0210110_10214182	3300025565	Natural And Restored Wetlands	MVRTYWLVPVFYEASGHLDLRPFARTDQIEACRPRAMCIRLYAGG
Ga0210085_10005213	3300025583	Natural And Restored Wetlands	MVRTYWFVPVFYEASGNLDLQPFARVDHVEACRPRGNC
Ga0210100_10558581	3300025780	Natural And Restored Wetlands	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRALLGIVGA
Ga0210063_100000661	3300025798	Natural And Restored Wetlands	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPHAMCIRLYAAG
Ga0210122_10544202	3300025799	Natural And Restored Wetlands	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMCNRL
Ga0210101_100010212	3300025814	Natural And Restored Wetlands	MVRTYWLVPVFNEASGHLGLQPFARTDQVEACRPRAMSLPIVRCRL
Ga0210144_10215322	3300025817	Natural And Restored Wetlands	MVRTYWLVPVFNEASGNLDLHPFARIGHVEACRPRAMYIDCSLCG
Ga0207642_1000003110	3300025899	Miscanthus Rhizosphere	MVRTYWLVPVFNEASGHLDLQPFARTDHVEACRPRAM
Ga0207642_107941751	3300025899	Miscanthus Rhizosphere	MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAWM
Ga0207710_1000015813	3300025900	Switchgrass Rhizosphere	MVRTYWLVPVFYEASGNLDLQPFARVDHVEACRPRAMCIRLYGAG
Ga0207643_103342782	3300025908	Miscanthus Rhizosphere	MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMSG
Ga0207693_101995252	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMWTDCTG
Ga0207663_100726673	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRA
Ga0207687_1000001895	3300025927	Miscanthus Rhizosphere	MVRTYWLVPVFNEASGNLDLQPFARTDHVEACRPRAMCTKCT
Ga0207690_1000106821	3300025932	Corn Rhizosphere	MVRTYWFVTGFNEASVNLDLQPFARIDHVEACRPRAWIRI
Ga0207670_100895633	3300025936	Switchgrass Rhizosphere	MVRTYWFLPGFNEASGNLDLQPFARTDHVEACRPRAM
Ga0207704_100001464	3300025938	Miscanthus Rhizosphere	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAW
Ga0207689_118141781	3300025942	Miscanthus Rhizosphere	MVRTYWLVPVFYEASGHLDLRPFARTDQIEACRPRAMCSSLYG
Ga0210068_10001082	3300025953	Natural And Restored Wetlands	MVRTYWLLPVFYEASGHLDLQPFARTDRVEACRPRAMCSRLYGPRTAIRSRGL
Ga0208535_10006083	3300026045	Natural And Restored Wetlands	MVRTYWLVPVFYEASGHLDLQPFARTDHVEACRPRAM
Ga0208421_10010693	3300026058	Natural And Restored Wetlands	MVRTYWLVPVFYEASGNLDLQPFARTDQIEACRPRAMWLPSVRRRVGWGK
Ga0207678_116590511	3300026067	Corn Rhizosphere	MVRTYWFVTVFYEASVNLDLQPFARVDHVEACRPRV
Ga0207708_102596702	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRALRFEF
Ga0207702_1000060746	3300026078	Corn Rhizosphere	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAPPF
Ga0207648_1000084811	3300026089	Miscanthus Rhizosphere	MVRTYWLVPVFYEASGHLDLRPFARTDRVEACRPRAM
Ga0207674_104545843	3300026116	Corn Rhizosphere	MVRTYWLVPVFHEASGHLDLQPFARTDQVEACRPRAMSALIVRF
Ga0209956_10091522	3300026127	Soil	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMWLPIVRGQVG
Ga0208996_10064991	3300027257	Forest Soil	MVRTYWLVPGFNEASGNLDLQPFARVDHVEACRPHALMHLEL
Ga0209462_100000373	3300027761	Agave	MVRTYWLVPVFYEASGHLDLQPFARTDRVEACRPRAMWVDCTV
Ga0209229_101956962	3300027805	Freshwater And Sediment	MVRTYWFLPIFYEAIGTLDLQPSARTDRVEACRPLGWCPPILRDR
Ga0210366_100039893	3300028420	Estuarine	MVRTSWLVPGFYEASGNLDLQSNARDNHVEAWRPRAMS
Ga0247818_109069012	3300028589	Soil	MVRTYWFFPVFYEASGNLDLQPFARIDHVEACRPRAMCLQLYGVG
Ga0307291_10047862	3300028707	Soil	MVRTYWLVPVFNEASGNLGLQPFARIDHVEACRPRAMCP
Ga0307303_101748191	3300028713	Soil	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAPPFYR
Ga0307315_100025821	3300028721	Soil	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRAWNAL
Ga0307319_10000002199	3300028722	Soil	MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRAWNA
Ga0307297_101453151	3300028754	Soil	MVRTYWFFPVFHEASGNLGLQPFARIDHVEACRPRAMYRRF
Ga0307280_101867621	3300028768	Soil	MVRTYWFLPGFNEASGNLDLQPFARTDHVEACRPRAMWS
Ga0307288_100650721	3300028778	Soil	MVRTYWLVPVFYEASGNLGLQPFARIDHVEACRPRAMCP
Ga0307282_100449972	3300028784	Soil	MVRTYWLVPVFNEASGNLDLQPFARTDRVEACRPRAMSAPIVRC
Ga0307282_103173721	3300028784	Soil	MVRTYWLVPVFNEASGNLDLQPFARTDHVEACRPRAMWTDCTR
Ga0307282_104712751	3300028784	Soil	LMVRTYWLVPVFNEASGNLDLQPFARIDQIETCRPRAMS
Ga0265338_111212971	3300028800	Rhizosphere	EGELMVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAGCI
Ga0307503_108539571	3300028802	Soil	MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRADCLNCT
Ga0307314_100066933	3300028872	Soil	MVRTYWFVTGFNEASVNLGLQPFARVDHVEACRPRAWFRP
Ga0307289_102314942	3300028875	Soil	MVRTYWLVPVFYEASGNLDLQPFARVDHVEACRPRAMCIRLYGAGYVAGL
Ga0311340_113573441	3300029943	Palsa	MVRTYWFVSGFNEASDNLDLQPLARIDHVEACRPRGEMHLK
Ga0307511_100632862	3300030521	Ectomycorrhiza	MVRTYWLVPGFNEASDNLDLRPFARIDQIEACRPRAMCHRLYGVADAGARI
Ga0307499_100020296	3300031184	Soil	MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMWLPIVRRRVRCDS
Ga0307496_100039854	3300031200	Soil	MVRTYWFLPGFNEASGNLDLQPFARTDHVEACRPRAYVQRLYGVG
Ga0299914_1000000597	3300031228	Soil	MVRTYWLVPVFYEASGHLDLQPFARIDQVEACRPRAM
Ga0299914_112984391	3300031228	Soil	ESELMVRTYWLVPVFYEASGNLDLQPVRTIDHVEACRPRAMCS
Ga0299914_113128151	3300031228	Soil	MVRTYWLVPVFYEASGNLDLQPVRTIDHVEACRPRAMWT
Ga0299913_100643006	3300031229	Soil	MVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPHAMCVPLYAAG
Ga0315297_100844782	3300031873	Sediment	MVRTYWFFPGFYEASGNLGLQPFALTTTSKPCRPRAMSHSIVRCEWV
Ga0316583_100168622	3300032133	Rhizosphere	MVRTYWLVPVFYEASGHLDLRPFARIDQIEACRPRAMWLPIVRRRVG
Ga0307470_100083934	3300032174	Hardwood Forest Soil	MVRTYWLVPVFNEASGHLDLQPFARIDRVEACRPRAMCSDCTV
Ga0307472_1000895163	3300032205	Hardwood Forest Soil	MVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPRAMCPPIVR
Ga0335085_1001894010	3300032770	Soil	MVRTYWLVPVFNEASGNLDLQPFARTDHVEACRPRAM
Ga0334905_002025_1675_1812	3300034687	Soil	MVRTYWLVPVFYEASGNLDLQPFARTDQVEACRPRAMCFRLYGVG

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign