| Basic Information | |
|---|---|
| Family ID | F027211 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 195 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAM |
| Number of Associated Samples | 171 |
| Number of Associated Scaffolds | 195 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.54 % |
| % of genes near scaffold ends (potentially truncated) | 35.38 % |
| % of genes from short scaffolds (< 2000 bps) | 56.41 % |
| Associated GOLD sequencing projects | 156 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.590 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.974 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.92% β-sheet: 0.00% Coil/Unstructured: 83.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 195 Family Scaffolds |
|---|---|---|
| PF07992 | Pyr_redox_2 | 29.23 |
| PF08534 | Redoxin | 7.18 |
| PF08002 | DUF1697 | 7.18 |
| PF12836 | HHH_3 | 4.10 |
| PF02566 | OsmC | 2.56 |
| PF01946 | Thi4 | 2.05 |
| PF12680 | SnoaL_2 | 1.54 |
| PF13483 | Lactamase_B_3 | 1.54 |
| PF00005 | ABC_tran | 1.54 |
| PF12848 | ABC_tran_Xtn | 1.03 |
| PF12850 | Metallophos_2 | 1.03 |
| PF12840 | HTH_20 | 1.03 |
| PF00528 | BPD_transp_1 | 1.03 |
| PF01909 | NTP_transf_2 | 1.03 |
| PF13354 | Beta-lactamase2 | 1.03 |
| PF01668 | SmpB | 1.03 |
| PF12849 | PBP_like_2 | 0.51 |
| PF01197 | Ribosomal_L31 | 0.51 |
| PF03951 | Gln-synt_N | 0.51 |
| PF02796 | HTH_7 | 0.51 |
| PF01012 | ETF | 0.51 |
| PF12681 | Glyoxalase_2 | 0.51 |
| PF00069 | Pkinase | 0.51 |
| PF13711 | DUF4160 | 0.51 |
| PF07883 | Cupin_2 | 0.51 |
| PF02643 | DUF192 | 0.51 |
| PF12697 | Abhydrolase_6 | 0.51 |
| PF00483 | NTP_transferase | 0.51 |
| PF07963 | N_methyl | 0.51 |
| PF01545 | Cation_efflux | 0.51 |
| PF05724 | TPMT | 0.51 |
| PF10518 | TAT_signal | 0.51 |
| PF03358 | FMN_red | 0.51 |
| PF01844 | HNH | 0.51 |
| PF13180 | PDZ_2 | 0.51 |
| PF00773 | RNB | 0.51 |
| PF03320 | FBPase_glpX | 0.51 |
| PF00497 | SBP_bac_3 | 0.51 |
| PF04607 | RelA_SpoT | 0.51 |
| PF04075 | F420H2_quin_red | 0.51 |
| PF16326 | ABC_tran_CTD | 0.51 |
| PF00903 | Glyoxalase | 0.51 |
| PF03572 | Peptidase_S41 | 0.51 |
| PF03721 | UDPG_MGDP_dh_N | 0.51 |
| PF00486 | Trans_reg_C | 0.51 |
| PF02870 | Methyltransf_1N | 0.51 |
| PF03640 | Lipoprotein_15 | 0.51 |
| PF01850 | PIN | 0.51 |
| PF00067 | p450 | 0.51 |
| PF02445 | NadA | 0.51 |
| PF01895 | PhoU | 0.51 |
| PF00939 | Na_sulph_symp | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 195 Family Scaffolds |
|---|---|---|---|
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 7.18 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 2.56 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 2.56 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.05 |
| COG1635 | Thiazole synthase/Archaeal ribulose 1,5-bisphosphate synthetase | Carbohydrate transport and metabolism [G] | 2.05 |
| COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 1.03 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.51 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.51 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.51 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.51 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.51 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.51 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.51 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.51 |
| COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 0.51 |
| COG1430 | Uncharacterized conserved membrane protein, UPF0127 family | Function unknown [S] | 0.51 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.51 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.51 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.51 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.51 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.51 |
| COG0379 | Quinolinate synthase | Coenzyme transport and metabolism [H] | 0.51 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.51 |
| COG0254 | Ribosomal protein L31 | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.51 |
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.00 % |
| Unclassified | root | N/A | 20.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908036|A5_v_NODE_32832_len_553_cov_7_448463 | Not Available | 603 | Open in IMG/M |
| 3300000956|JGI10216J12902_101819453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300001333|A21PFW6_1018107 | All Organisms → cellular organisms → Bacteria | 6002 | Open in IMG/M |
| 3300001977|JGI24746J21847_1013386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1194 | Open in IMG/M |
| 3300002408|B570J29032_108884395 | Not Available | 532 | Open in IMG/M |
| 3300002568|C688J35102_119554444 | Not Available | 718 | Open in IMG/M |
| 3300003203|JGI25406J46586_10060811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1220 | Open in IMG/M |
| 3300003418|JGI26523J50269_1010362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2043 | Open in IMG/M |
| 3300003659|JGI25404J52841_10001998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3760 | Open in IMG/M |
| 3300003988|Ga0055475_10092387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 912 | Open in IMG/M |
| 3300004003|Ga0055445_10283152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300004004|Ga0055451_10149602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 945 | Open in IMG/M |
| 3300004006|Ga0055453_10021430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1591 | Open in IMG/M |
| 3300004010|Ga0055474_10014164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2002 | Open in IMG/M |
| 3300004026|Ga0055443_10225532 | Not Available | 593 | Open in IMG/M |
| 3300004065|Ga0055481_10120169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1113 | Open in IMG/M |
| 3300005183|Ga0068993_10019559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1694 | Open in IMG/M |
| 3300005337|Ga0070682_100000045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 131960 | Open in IMG/M |
| 3300005337|Ga0070682_100177111 | Not Available | 1486 | Open in IMG/M |
| 3300005339|Ga0070660_100456138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1061 | Open in IMG/M |
| 3300005365|Ga0070688_100000630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 17586 | Open in IMG/M |
| 3300005365|Ga0070688_100345487 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300005366|Ga0070659_100001961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14692 | Open in IMG/M |
| 3300005441|Ga0070700_100089312 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300005447|Ga0066689_10230248 | Not Available | 1134 | Open in IMG/M |
| 3300005455|Ga0070663_101503810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300005466|Ga0070685_10405637 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300005563|Ga0068855_102613087 | Not Available | 501 | Open in IMG/M |
| 3300005576|Ga0066708_10638584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300005578|Ga0068854_100345861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1216 | Open in IMG/M |
| 3300005614|Ga0068856_100001194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 27371 | Open in IMG/M |
| 3300005718|Ga0068866_10000001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 519680 | Open in IMG/M |
| 3300005840|Ga0068870_10604507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 745 | Open in IMG/M |
| 3300006042|Ga0075368_10539504 | Not Available | 523 | Open in IMG/M |
| 3300006046|Ga0066652_100144349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1987 | Open in IMG/M |
| 3300006237|Ga0097621_101476667 | Not Available | 645 | Open in IMG/M |
| 3300006575|Ga0074053_11877087 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300006576|Ga0074047_11972893 | Not Available | 514 | Open in IMG/M |
| 3300006606|Ga0074062_12627354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1705 | Open in IMG/M |
| 3300006640|Ga0075527_10014248 | Not Available | 2043 | Open in IMG/M |
| 3300006755|Ga0079222_10141190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1351 | Open in IMG/M |
| 3300006796|Ga0066665_11135343 | Not Available | 595 | Open in IMG/M |
| 3300006806|Ga0079220_11810796 | Not Available | 538 | Open in IMG/M |
| 3300006853|Ga0075420_100183171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1832 | Open in IMG/M |
| 3300006881|Ga0068865_100000104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 43423 | Open in IMG/M |
| 3300006881|Ga0068865_100126446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1909 | Open in IMG/M |
| 3300006904|Ga0075424_101479355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
| 3300006954|Ga0079219_11749153 | Not Available | 579 | Open in IMG/M |
| 3300007769|Ga0102952_1058880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1157 | Open in IMG/M |
| 3300009098|Ga0105245_10000016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 204372 | Open in IMG/M |
| 3300009101|Ga0105247_10009385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5941 | Open in IMG/M |
| 3300009112|Ga0115923_10236424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1860 | Open in IMG/M |
| 3300009148|Ga0105243_11593734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300009156|Ga0111538_11819721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 766 | Open in IMG/M |
| 3300009840|Ga0126313_10441810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1036 | Open in IMG/M |
| 3300010045|Ga0126311_10910233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 715 | Open in IMG/M |
| 3300010051|Ga0133939_1111441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1570 | Open in IMG/M |
| 3300010166|Ga0126306_10077699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2358 | Open in IMG/M |
| 3300010359|Ga0126376_11156566 | Not Available | 786 | Open in IMG/M |
| 3300010362|Ga0126377_10702808 | Not Available | 1064 | Open in IMG/M |
| 3300010375|Ga0105239_10227514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2092 | Open in IMG/M |
| 3300010397|Ga0134124_11344304 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300010400|Ga0134122_10060775 | All Organisms → cellular organisms → Bacteria | 2918 | Open in IMG/M |
| 3300010400|Ga0134122_11453290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 702 | Open in IMG/M |
| 3300010403|Ga0134123_12044559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
| 3300011107|Ga0151490_1330005 | Not Available | 502 | Open in IMG/M |
| 3300011418|Ga0153954_1009011 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300012912|Ga0157306_10002201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3613 | Open in IMG/M |
| 3300012915|Ga0157302_10000003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 168510 | Open in IMG/M |
| 3300012924|Ga0137413_10251248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1214 | Open in IMG/M |
| 3300012939|Ga0162650_100001716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2154 | Open in IMG/M |
| 3300012958|Ga0164299_10000007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 126092 | Open in IMG/M |
| 3300012984|Ga0164309_10861090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 735 | Open in IMG/M |
| 3300012985|Ga0164308_10013850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 4500 | Open in IMG/M |
| 3300012987|Ga0164307_11742222 | Not Available | 528 | Open in IMG/M |
| 3300012988|Ga0164306_10004359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6778 | Open in IMG/M |
| 3300013102|Ga0157371_10015152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5791 | Open in IMG/M |
| 3300013104|Ga0157370_10046026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4184 | Open in IMG/M |
| 3300013104|Ga0157370_10051847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3918 | Open in IMG/M |
| 3300013105|Ga0157369_10000110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 115514 | Open in IMG/M |
| 3300013105|Ga0157369_11343769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus → Pedococcus cremeus | 728 | Open in IMG/M |
| 3300013296|Ga0157374_10034901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4599 | Open in IMG/M |
| 3300013306|Ga0163162_10651873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1176 | Open in IMG/M |
| 3300013308|Ga0157375_10026721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 5385 | Open in IMG/M |
| 3300013503|Ga0120127_10000100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 22685 | Open in IMG/M |
| 3300014265|Ga0075314_1001076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 4969 | Open in IMG/M |
| 3300014267|Ga0075313_1014444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1781 | Open in IMG/M |
| 3300014301|Ga0075323_1000920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 3769 | Open in IMG/M |
| 3300014310|Ga0075331_1068615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300014325|Ga0163163_10400726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1430 | Open in IMG/M |
| 3300014326|Ga0157380_10000815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 19534 | Open in IMG/M |
| 3300014326|Ga0157380_11537940 | Not Available | 719 | Open in IMG/M |
| 3300014487|Ga0182000_10252739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300014827|Ga0120171_1152424 | Not Available | 528 | Open in IMG/M |
| 3300015089|Ga0167643_1018892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1048 | Open in IMG/M |
| 3300015090|Ga0167634_1016618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
| 3300015371|Ga0132258_11204640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1914 | Open in IMG/M |
| 3300018027|Ga0184605_10297219 | Not Available | 732 | Open in IMG/M |
| 3300018061|Ga0184619_10027827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2363 | Open in IMG/M |
| 3300018066|Ga0184617_1277688 | Not Available | 504 | Open in IMG/M |
| 3300018422|Ga0190265_10000299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 39882 | Open in IMG/M |
| 3300018422|Ga0190265_10017886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5573 | Open in IMG/M |
| 3300018422|Ga0190265_10136877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2370 | Open in IMG/M |
| 3300018422|Ga0190265_10668738 | Not Available | 1159 | Open in IMG/M |
| 3300018422|Ga0190265_10686569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1145 | Open in IMG/M |
| 3300018429|Ga0190272_10000206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 36212 | Open in IMG/M |
| 3300018429|Ga0190272_10000535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 19632 | Open in IMG/M |
| 3300018432|Ga0190275_10497714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1252 | Open in IMG/M |
| 3300018432|Ga0190275_13252213 | Not Available | 526 | Open in IMG/M |
| 3300018469|Ga0190270_11793800 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300018476|Ga0190274_10372894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1369 | Open in IMG/M |
| 3300018476|Ga0190274_11415226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300018481|Ga0190271_10003147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 10268 | Open in IMG/M |
| 3300018920|Ga0190273_10000677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12408 | Open in IMG/M |
| 3300018920|Ga0190273_10145517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1407 | Open in IMG/M |
| 3300019889|Ga0193743_1061721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1560 | Open in IMG/M |
| 3300020002|Ga0193730_1009615 | All Organisms → cellular organisms → Bacteria | 2725 | Open in IMG/M |
| 3300020016|Ga0193696_1017635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1924 | Open in IMG/M |
| 3300020020|Ga0193738_1147376 | Not Available | 633 | Open in IMG/M |
| 3300020021|Ga0193726_1011771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4674 | Open in IMG/M |
| 3300020021|Ga0193726_1317033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300020082|Ga0206353_10759580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1208 | Open in IMG/M |
| 3300021339|Ga0193706_1078498 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300021339|Ga0193706_1126276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 696 | Open in IMG/M |
| 3300021344|Ga0193719_10151356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1001 | Open in IMG/M |
| 3300021510|Ga0222621_1053559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. RAC08 | 846 | Open in IMG/M |
| 3300022899|Ga0247795_1000394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7246 | Open in IMG/M |
| 3300023102|Ga0247754_1000337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6768 | Open in IMG/M |
| 3300024981|Ga0209934_1015471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1831 | Open in IMG/M |
| 3300025321|Ga0207656_10000116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 30697 | Open in IMG/M |
| 3300025556|Ga0210120_1006128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2500 | Open in IMG/M |
| 3300025565|Ga0210110_1000003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 132808 | Open in IMG/M |
| 3300025565|Ga0210110_1003169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 4681 | Open in IMG/M |
| 3300025565|Ga0210110_1021418 | Not Available | 1668 | Open in IMG/M |
| 3300025583|Ga0210085_1000521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 16078 | Open in IMG/M |
| 3300025780|Ga0210100_1055858 | Not Available | 566 | Open in IMG/M |
| 3300025798|Ga0210063_1000006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 216102 | Open in IMG/M |
| 3300025799|Ga0210122_1054420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 917 | Open in IMG/M |
| 3300025814|Ga0210101_1000102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 29431 | Open in IMG/M |
| 3300025817|Ga0210144_1021532 | Not Available | 2085 | Open in IMG/M |
| 3300025899|Ga0207642_10000031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 45198 | Open in IMG/M |
| 3300025899|Ga0207642_10794175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. RAC08 | 602 | Open in IMG/M |
| 3300025900|Ga0207710_10000158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 72527 | Open in IMG/M |
| 3300025908|Ga0207643_10334278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 948 | Open in IMG/M |
| 3300025915|Ga0207693_10199525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1573 | Open in IMG/M |
| 3300025916|Ga0207663_10072667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2224 | Open in IMG/M |
| 3300025927|Ga0207687_10000018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 236159 | Open in IMG/M |
| 3300025932|Ga0207690_10001068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17537 | Open in IMG/M |
| 3300025936|Ga0207670_10089563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2172 | Open in IMG/M |
| 3300025938|Ga0207704_10000146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 37894 | Open in IMG/M |
| 3300025942|Ga0207689_11814178 | Not Available | 503 | Open in IMG/M |
| 3300025953|Ga0210068_1000108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12682 | Open in IMG/M |
| 3300026045|Ga0208535_1000608 | All Organisms → cellular organisms → Bacteria | 4100 | Open in IMG/M |
| 3300026058|Ga0208421_1001069 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300026067|Ga0207678_11659051 | Not Available | 562 | Open in IMG/M |
| 3300026075|Ga0207708_10259670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1402 | Open in IMG/M |
| 3300026078|Ga0207702_10000607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 39638 | Open in IMG/M |
| 3300026089|Ga0207648_10000848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 34516 | Open in IMG/M |
| 3300026116|Ga0207674_10454584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus → Pedococcus cremeus | 1238 | Open in IMG/M |
| 3300026127|Ga0209956_1009152 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300027257|Ga0208996_1006499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1365 | Open in IMG/M |
| 3300027761|Ga0209462_10000037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 11818 | Open in IMG/M |
| 3300028420|Ga0210366_10003989 | All Organisms → cellular organisms → Bacteria | 3676 | Open in IMG/M |
| 3300028589|Ga0247818_10906901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300028707|Ga0307291_1004786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2891 | Open in IMG/M |
| 3300028713|Ga0307303_10174819 | Not Available | 524 | Open in IMG/M |
| 3300028721|Ga0307315_10002582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4376 | Open in IMG/M |
| 3300028722|Ga0307319_10000002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 329528 | Open in IMG/M |
| 3300028754|Ga0307297_10145315 | Not Available | 806 | Open in IMG/M |
| 3300028768|Ga0307280_10186762 | Not Available | 728 | Open in IMG/M |
| 3300028778|Ga0307288_10065072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1280 | Open in IMG/M |
| 3300028784|Ga0307282_10044997 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300028784|Ga0307282_10317372 | Not Available | 752 | Open in IMG/M |
| 3300028784|Ga0307282_10471275 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300028800|Ga0265338_11121297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300028802|Ga0307503_10853957 | Not Available | 523 | Open in IMG/M |
| 3300028872|Ga0307314_10006693 | All Organisms → cellular organisms → Bacteria | 2426 | Open in IMG/M |
| 3300028875|Ga0307289_10231494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300029943|Ga0311340_11357344 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300030521|Ga0307511_10063286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2796 | Open in IMG/M |
| 3300031184|Ga0307499_10002029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5322 | Open in IMG/M |
| 3300031200|Ga0307496_10003985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1639 | Open in IMG/M |
| 3300031228|Ga0299914_10000005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 187644 | Open in IMG/M |
| 3300031228|Ga0299914_11298439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300031228|Ga0299914_11312815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300031229|Ga0299913_10064300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3529 | Open in IMG/M |
| 3300031873|Ga0315297_10084478 | Not Available | 2488 | Open in IMG/M |
| 3300032133|Ga0316583_10016862 | All Organisms → cellular organisms → Bacteria | 2627 | Open in IMG/M |
| 3300032174|Ga0307470_10008393 | All Organisms → cellular organisms → Bacteria | 4170 | Open in IMG/M |
| 3300032205|Ga0307472_100089516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2078 | Open in IMG/M |
| 3300032770|Ga0335085_10018940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9870 | Open in IMG/M |
| 3300034687|Ga0334905_002025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 2914 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.59% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 10.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.13% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.05% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.54% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.54% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.03% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.03% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.03% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.03% |
| Wastewater Bioreactor | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor | 1.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.51% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.51% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.51% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.51% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.51% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.51% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.51% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.51% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.51% |
| Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.51% |
| Swimming Pool Sandfilter Backwash | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908036 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001333 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003418 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_biof | Engineered | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004003 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 | Environmental | Open in IMG/M |
| 3300004004 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 | Environmental | Open in IMG/M |
| 3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
| 3300004010 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D1 | Environmental | Open in IMG/M |
| 3300004026 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 | Environmental | Open in IMG/M |
| 3300004065 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007769 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009112 | Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2 | Engineered | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011418 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015090 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300024981 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_plan (SPAdes) | Engineered | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025565 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025583 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025780 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025798 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025799 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025814 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025817 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026045 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026058 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026127 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027257 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027761 | Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300034687 | Soil microbial communities from Mojave Desert, California, United States - 1NOC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_v_00034170 | 2124908036 | Soil | MVRTYWFFPGFYEASGNLGLQPFARIDCVEACRPRAMYGPILPAVNRRPKK |
| JGI10216J12902_1018194531 | 3300000956 | Soil | GEGELMVRTLFFPVFNEASGNLGLQPFARIDHVEA* |
| A21PFW6_10181073 | 3300001333 | Permafrost | MVRTYWLVPGFNEASGNLDLRPFARIDQIEACRPRAMCPPIVR* |
| JGI24746J21847_10133864 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRTYWLVPVFYEASGNLDLQPFARTDQVEACRPRAMCIPLYALG* |
| B570J29032_1088843952 | 3300002408 | Freshwater | MVRTYWFLPIFYEAIDILDLQPSARTDLVEACRPRR* |
| C688J35102_1195544442 | 3300002568 | Soil | MVRTYWFLPVFYEASGHLDLQPFARTDHVEACRPRAMCLQLYGVVLGPE* |
| JGI25406J46586_100608112 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MVRTYWFVSGFNEASDNLDLQPFARIDHVEACRPRANFA* |
| JGI26523J50269_10103622 | 3300003418 | Wastewater Bioreactor | MVRTYWFVPIFYEAIDILDLQPSARSDNVEACRPLGWCTTIVR* |
| JGI25404J52841_100019986 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAGCI* |
| Ga0055475_100923871 | 3300003988 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMCNR |
| Ga0055455_100179741 | 3300003990 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGNLDLRPFARTDQIGLSPPCYVLSIVRGPVG* |
| Ga0055445_102831522 | 3300004003 | Natural And Restored Wetlands | MVRTYWFVPVFYEASGNLDLQPFARVDHVEACRPRALLISIVGRTGRMGL* |
| Ga0055451_101496021 | 3300004004 | Natural And Restored Wetlands | VRTYWLVPVFNEASGHLDLQPFARIDQVEACRPRAMWLPIVRCRA* |
| Ga0055453_100214302 | 3300004006 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMCSRLYGVRSGRLEA* |
| Ga0055474_100141642 | 3300004010 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPHAMCIRLYAAG* |
| Ga0055443_102255322 | 3300004026 | Natural And Restored Wetlands | MVRTSWLVPGFYEASGNLDLQSNARDNHVEAWRPRAMSDY |
| Ga0055481_101201692 | 3300004065 | Natural And Restored Wetlands | EGELMVRTYWLVPVFNEASGHLDLQPFARTDQVEACRPRAMWLPIVRCRA* |
| Ga0068993_100195595 | 3300005183 | Natural And Restored Wetlands | MVRTYWLLPVFYEASGHLDLQPFARTDRVEACRPRAMCSRLYGP |
| Ga0070682_10000004550 | 3300005337 | Corn Rhizosphere | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRAWDTH* |
| Ga0070682_1001771111 | 3300005337 | Corn Rhizosphere | MVRTYWFVPGFNEASDNLDLQPFARVDHVEACRPRTLRFEL* |
| Ga0070660_1004561381 | 3300005339 | Corn Rhizosphere | LSGEGELMVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAWIRI* |
| Ga0070688_10000063020 | 3300005365 | Switchgrass Rhizosphere | GELMVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDALGL* |
| Ga0070688_1003454872 | 3300005365 | Switchgrass Rhizosphere | MVRTYWLLPVFNEASGHLDLQPFARIDRVEACRPRAMCFQLYGVA* |
| Ga0070659_1000019613 | 3300005366 | Corn Rhizosphere | MVRTYWFVTGFNEASVNLDLQPFARIDHVEACRPRAWIRI* |
| Ga0070700_1000893124 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRTYWFVSGFNEASDNLDLQPFARVDHVEACRPRALRFEF* |
| Ga0066689_102302482 | 3300005447 | Soil | MVRTYWFFPVFSEASGNLGLQPSARIDQIEACRPRAMSW* |
| Ga0070663_1015038101 | 3300005455 | Corn Rhizosphere | SEGELMVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPRAMWHRLYGAG* |
| Ga0070685_104056372 | 3300005466 | Switchgrass Rhizosphere | MVRTYWLLPVFNEASGHLDLQPFARIDRVEACRPRAMCLELYGVA* |
| Ga0068855_1026130871 | 3300005563 | Corn Rhizosphere | MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRA |
| Ga0066708_106385842 | 3300005576 | Soil | GEGELMVRTYWFFPVFSEASGNLGLQPSARIDQIEACRPRAMWW* |
| Ga0068854_1003458612 | 3300005578 | Corn Rhizosphere | MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMSLRLYGVG* |
| Ga0068856_1000011941 | 3300005614 | Corn Rhizosphere | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAPPF* |
| Ga0068866_10000001241 | 3300005718 | Miscanthus Rhizosphere | MVRTYWLVPVFNEASGHLDLQPFARTDHVEACRPRAM* |
| Ga0068870_106045072 | 3300005840 | Miscanthus Rhizosphere | MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRA |
| Ga0075368_105395041 | 3300006042 | Populus Endosphere | VVRSSWFFLVFYEASRNLDLQSVARNNHVEACRPR |
| Ga0066652_1001443493 | 3300006046 | Soil | MVRTYWFFPVFNEASGNLGLQPFARIDHVEACRPRAMSLPIG* |
| Ga0097621_1014766672 | 3300006237 | Miscanthus Rhizosphere | MVRTYWFVSGFNEASDNLDLQPFARIDHVEACRPR |
| Ga0074053_118770872 | 3300006575 | Soil | MVRTYWLVPVFNEASGHLGLQPFARTDQVEACRPRAMWPLIVR* |
| Ga0074047_119728931 | 3300006576 | Soil | MVRTYWFVSGFNEASDNLDLQPFARVDHVEACRPR |
| Ga0074062_126273543 | 3300006606 | Soil | MVRTYWLVPVFNEASDHLDLQPFARIDRVEACRPRAMCS* |
| Ga0075527_100142482 | 3300006640 | Arctic Peat Soil | MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMCIRLYAGG* |
| Ga0079222_101411902 | 3300006755 | Agricultural Soil | MVRTYWLVPVFYEASGHLDLRPFARTDRVEACRPRAM* |
| Ga0066665_111353432 | 3300006796 | Soil | MVRTYWFFPVFSEASGNLGLQPSAWIDQIEACRPRAMWW* |
| Ga0079220_118107961 | 3300006806 | Agricultural Soil | MVRTYWLVPVFNEASDNLGLQPFARIDHVEACRPRAMCAV |
| Ga0075420_1001831714 | 3300006853 | Populus Rhizosphere | LPVFYEASGNLDLQPFARVDHVETCRPRAMYAPEDTR |
| Ga0068865_10000010417 | 3300006881 | Miscanthus Rhizosphere | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAW* |
| Ga0068865_1001264464 | 3300006881 | Miscanthus Rhizosphere | MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPR |
| Ga0075424_1014793552 | 3300006904 | Populus Rhizosphere | YWLVPVFNEASGNLGLQPFARIDQIEACRPRAMSL* |
| Ga0079219_117491531 | 3300006954 | Agricultural Soil | MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRAWNA |
| Ga0102952_10588802 | 3300007769 | Soil | MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMWLPIVRGQVG* |
| Ga0105245_10000016129 | 3300009098 | Miscanthus Rhizosphere | MVRTYWLVPVFNEASGNLDLQPFARTDHVEACRPRAMCTKCT* |
| Ga0105247_100093857 | 3300009101 | Switchgrass Rhizosphere | MVRTYWLVPVFYEASGNLDLQPFARVDHVEACRPRAMCIRLYGAG* |
| Ga0115923_102364243 | 3300009112 | Swimming Pool Sandfilter Backwash | MVRTYWFVSGFNEASDNLDLQPFARIDHVEACRPRAHFA* |
| Ga0105243_115937342 | 3300009148 | Miscanthus Rhizosphere | MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRATAHRLYGVG* |
| Ga0111538_118197212 | 3300009156 | Populus Rhizosphere | MVRTYWFLPGFNEASGNLDLQPFARVDHVETCRPRAMYAPED |
| Ga0126313_104418102 | 3300009840 | Serpentine Soil | MVRTYWLVSGFNEASDNLDLQPFARVDHVEACRPRALRFQL* |
| Ga0126311_109102332 | 3300010045 | Serpentine Soil | MVRTYWCVLGFNEASSNLDLQPCARVDHVEACRPRAWECLP |
| Ga0133939_11114411 | 3300010051 | Industrial Wastewater | MVRTYWLVPVFYEASGNLGLQPFARCDHVEACRPRAMY |
| Ga0126306_100776992 | 3300010166 | Serpentine Soil | MVRTYWFVPGFNEASDNLDLQPFARVDHVEACRPRALPFEF* |
| Ga0126376_111565661 | 3300010359 | Tropical Forest Soil | MVRTYWLLPVFYEASGHLDLQPFARTDHVEACRPRAMCLQLYGV |
| Ga0126377_107028081 | 3300010362 | Tropical Forest Soil | MVRTYWFVPGFNEASGNLDLQPFARVDHVEACRPRACCASN |
| Ga0105239_102275141 | 3300010375 | Corn Rhizosphere | EGELMVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDALRL* |
| Ga0134124_113443042 | 3300010397 | Terrestrial Soil | MVRTYWFVPGFNEASGNLDLQPFARVDHVEACRPRAC |
| Ga0134122_100607752 | 3300010400 | Terrestrial Soil | MVRTYWFLPGFNEASGNLDLQPFARTDHVEACRPRAM* |
| Ga0134122_114532901 | 3300010400 | Terrestrial Soil | MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPHARCTSIVR |
| Ga0134123_120445591 | 3300010403 | Terrestrial Soil | MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAM |
| Ga0151490_13300052 | 3300011107 | Soil | MVRTYWFLPGVNEAACNLDLQPFARTDHVEACRPRAMCRA |
| Ga0153954_10090113 | 3300011418 | Attine Ant Fungus Gardens | MVRTYWFVSGFNEASDNLDLQPFARIDHVEACRPRAWCI* |
| Ga0137370_103734822 | 3300012285 | Vadose Zone Soil | MVRTYWFFPVFYEASGNLDLQPFARIDQIDACRPRAMSWQRFYRSGYI* |
| Ga0157306_100022013 | 3300012912 | Soil | MVRTYWLVPVFYEASGNLDLQPFARTDHVEACRPRAMS* |
| Ga0157302_1000000341 | 3300012915 | Soil | MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRAAAHRLYGVG* |
| Ga0137413_102512481 | 3300012924 | Vadose Zone Soil | MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRA |
| Ga0162650_1000017165 | 3300012939 | Soil | MVRTYWLVPGFNEAAGNLDLQPSARIDHVEACRPRALCIRLYFAG* |
| Ga0164299_10000007101 | 3300012958 | Soil | MVRTYWLVPVFNEASGNLVLRPFARIDQIEACRPRAMWLPIVR* |
| Ga0164309_108610901 | 3300012984 | Soil | MVRTYWLVPVFNEASGNLDLQPFARIDHVEACRPRAM |
| Ga0164308_100138503 | 3300012985 | Soil | MVRTYWLVPVFNEASGNLDLRPFARIDQIEACRPRAMWLPIVR* |
| Ga0164307_117422222 | 3300012987 | Soil | MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMCPQLYGVVLGTR* |
| Ga0164306_100043592 | 3300012988 | Soil | MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRAAAHRLYVVG* |
| Ga0157371_100151526 | 3300013102 | Corn Rhizosphere | MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRACDAL* |
| Ga0157370_100460265 | 3300013104 | Corn Rhizosphere | MVRTYWLVPGFNEASGNLDLRPFARIDQIEACRPRAM* |
| Ga0157370_100518471 | 3300013104 | Corn Rhizosphere | MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRAW |
| Ga0157369_100001103 | 3300013105 | Corn Rhizosphere | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAL* |
| Ga0157369_113437692 | 3300013105 | Corn Rhizosphere | MVRTYWLVPVFHEASGHLDLQPFARTDQVEACRPRAMSHSIVRCP |
| Ga0157374_100349015 | 3300013296 | Miscanthus Rhizosphere | MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRALRHRLYGVG* |
| Ga0163162_106518732 | 3300013306 | Switchgrass Rhizosphere | MVRTYWFVPGFNEASDNLDLQPFARVDHVEACRPRALRFEL* |
| Ga0157375_100267215 | 3300013308 | Miscanthus Rhizosphere | MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRALQHRLYGVG* |
| Ga0120127_1000010023 | 3300013503 | Permafrost | MVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPRAM* |
| Ga0075314_10010763 | 3300014265 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGHLDLQPFARTDHVEACRPRAM* |
| Ga0075313_10144443 | 3300014267 | Natural And Restored Wetlands | EGELMVRTYWLVPVFNEASGHLDLQPFARTDRIEACRPRAMSHTIVR* |
| Ga0075323_10009206 | 3300014301 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGNLDLQPFARTDQIEACRPRAMWLPSVRRRVGWGK* |
| Ga0075331_10686152 | 3300014310 | Natural And Restored Wetlands | MVRTYWLVPVFNEASGHLGLQPFARISQVEACRPRAMCIQLYGSERE* |
| Ga0163163_104007262 | 3300014325 | Switchgrass Rhizosphere | MVRTYWLLPVFNEASGHLDLQPFARTDYVEACRPRAMCLQLYGVA* |
| Ga0157380_100008157 | 3300014326 | Switchgrass Rhizosphere | MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAM* |
| Ga0157380_115379401 | 3300014326 | Switchgrass Rhizosphere | MVRTYWLVPVFNEASGNLDLQPFARIDHVEACRPRAMCPQL* |
| Ga0182000_102527392 | 3300014487 | Soil | EGELMVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDA* |
| Ga0120171_11524241 | 3300014827 | Permafrost | MVRTYWFFPGFYEASGNLDLQPFARIDRVEACRPRAMC |
| Ga0167643_10188922 | 3300015089 | Glacier Forefield Soil | MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAGCIWE |
| Ga0167634_10166181 | 3300015090 | Glacier Forefield Soil | MVRTYWLVPGFNEASDNLDLQPFARIDQIEACRPRAMWHRLYGAG* |
| Ga0132258_112046401 | 3300015371 | Arabidopsis Rhizosphere | GELMVRTYWFLPGFNEASGNLDLQPFARTDHVEACRPRAM* |
| Ga0184605_102972192 | 3300018027 | Groundwater Sediment | MVRTYWFFPGFYEASGNLDLQPFARIDCVEACRPRAMYALILRRERH |
| Ga0184619_100278272 | 3300018061 | Groundwater Sediment | MVRTYWFFPVFSEASGNLGLQPSARIDQIEACRPRALS |
| Ga0184617_12776881 | 3300018066 | Groundwater Sediment | MVRTYWFFPVFHEASGNLGLQPFARIDHVEACRPRAMCRRFYRRR |
| Ga0190265_1000029916 | 3300018422 | Soil | MVRTYWLVPVFYEASGNLDLQPFARIDYVEACRPRAMCS |
| Ga0190265_100178861 | 3300018422 | Soil | MVRTYWLVPVFNEASGNLDLQPFARIDQIEACRPRAMCVRLYAAVDA |
| Ga0190265_101368771 | 3300018422 | Soil | MVRTYWLVPGFNEASGNLGLQPVARIGQVEACHPRAMS |
| Ga0190265_106687382 | 3300018422 | Soil | GELMVRTYWLVPGFNEASGNLGLQPVARIGQVEACHPRAMSVPLRLYGVG |
| Ga0190265_106865692 | 3300018422 | Soil | LSGEGELMVRTYWLVPVFYEASGNLDLQPFARIDYVEACRPRAMCF |
| Ga0190272_1000020632 | 3300018429 | Soil | MVRTYWLVPGFNEASGNLGLQPVARIGQVEACHPRAMSVPLRLYGVG |
| Ga0190272_100005358 | 3300018429 | Soil | MVRTYWLVPGFNEASGNLDLQPFARIDHVEACRPRALRIPLYGAG |
| Ga0190275_104977142 | 3300018432 | Soil | VRTYWFVSGFNEASDNLDLQPFARVDHVEACRPRALRFEL |
| Ga0190275_132522131 | 3300018432 | Soil | MVRNSWFFPVFYEASGNLDLQPNARDNRVEACRPRAMC |
| Ga0190270_117938002 | 3300018469 | Soil | MVRNYGFLPVFNEASGNLGLQPYARIDHVEACRPP |
| Ga0190274_103728941 | 3300018476 | Soil | MVRTYWLVPVFYEASGNLDLQPFARIDQIEACRPRAMSAPIVR |
| Ga0190274_114152262 | 3300018476 | Soil | LVPGFNEASGNLDLQPFARVDHVEACRPRALRFEL |
| Ga0190271_100031478 | 3300018481 | Soil | MVRTYWLVPVFNEASGNLDLQPFARVDHVEACRPRAMRIQLYAAG |
| Ga0190273_100006778 | 3300018920 | Soil | MVRTYWFVTGFNEASVNLDLQPFTRVDHVEACRPRACAA |
| Ga0190273_101455172 | 3300018920 | Soil | MVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPRAM |
| Ga0193743_10617211 | 3300019889 | Soil | MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAG |
| Ga0193730_10096152 | 3300020002 | Soil | MVRTYWFFPGFYEASGNLDLQPFARIDCVEACRPRAM |
| Ga0193696_10176352 | 3300020016 | Soil | MVRTYWLVPVFNEASGNLDLQPFARIDQIEACRPRAMSASIVRCRVAMAK |
| Ga0193738_11473761 | 3300020020 | Soil | MVRTYWFVLGFNEASSNLDLQPFTRVDHVEACRPRAWE |
| Ga0193726_10117715 | 3300020021 | Soil | MVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPRAMWHRLYGAG |
| Ga0193726_13170332 | 3300020021 | Soil | DRLLRLSYELSGKGELMVRTYWFVSGFNEASDNLDLQPFARNDHVEACRPRTRCI |
| Ga0206353_107595801 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRAWDTH |
| Ga0193706_10784982 | 3300021339 | Soil | MVRTYWFVPGFNEASGNLDLQPFARTDHVEACRPRALQHRLYGVG |
| Ga0193706_11262761 | 3300021339 | Soil | LSGEGELMVRTYWLVPGFNEASGNLDLQPSARIDHVEACRPRALRIPLYGAG |
| Ga0193719_101513562 | 3300021344 | Soil | MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMSCLTRLYGVA |
| Ga0222621_10535591 | 3300021510 | Groundwater Sediment | MVRTYWLVPVFNEASDHLDLQPFARTDRVEACRPRAMCF |
| Ga0247795_10003944 | 3300022899 | Soil | MVRTYWFVTGFNEASVNLDLQPFARVDHVEACRPRAWNAH |
| Ga0247754_10003374 | 3300023102 | Soil | MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMCIRLYGVG |
| Ga0209934_10154711 | 3300024981 | Wastewater Bioreactor | MVRTYWFVPIFYEAIDILDLQPSARSDNVEACRPLGWCTTIVR |
| Ga0207656_1000011627 | 3300025321 | Corn Rhizosphere | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRAWDTH |
| Ga0210120_10061283 | 3300025556 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMCSRLYGVRSGRLEA |
| Ga0210110_100000337 | 3300025565 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGHLDLRPFARTDQIEACRPRAMWLPIVRGRVG |
| Ga0210110_10031693 | 3300025565 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMWLPIVRGRVG |
| Ga0210110_10214182 | 3300025565 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGHLDLRPFARTDQIEACRPRAMCIRLYAGG |
| Ga0210085_10005213 | 3300025583 | Natural And Restored Wetlands | MVRTYWFVPVFYEASGNLDLQPFARVDHVEACRPRGNC |
| Ga0210100_10558581 | 3300025780 | Natural And Restored Wetlands | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRALLGIVGA |
| Ga0210063_100000661 | 3300025798 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPHAMCIRLYAAG |
| Ga0210122_10544202 | 3300025799 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMCNRL |
| Ga0210101_100010212 | 3300025814 | Natural And Restored Wetlands | MVRTYWLVPVFNEASGHLGLQPFARTDQVEACRPRAMSLPIVRCRL |
| Ga0210144_10215322 | 3300025817 | Natural And Restored Wetlands | MVRTYWLVPVFNEASGNLDLHPFARIGHVEACRPRAMYIDCSLCG |
| Ga0207642_1000003110 | 3300025899 | Miscanthus Rhizosphere | MVRTYWLVPVFNEASGHLDLQPFARTDHVEACRPRAM |
| Ga0207642_107941751 | 3300025899 | Miscanthus Rhizosphere | MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAWM |
| Ga0207710_1000015813 | 3300025900 | Switchgrass Rhizosphere | MVRTYWLVPVFYEASGNLDLQPFARVDHVEACRPRAMCIRLYGAG |
| Ga0207643_103342782 | 3300025908 | Miscanthus Rhizosphere | MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMSG |
| Ga0207693_101995252 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRTYWLVPGFNEASGNLDLQPFARTDHVEACRPRAMWTDCTG |
| Ga0207663_100726673 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRA |
| Ga0207687_1000001895 | 3300025927 | Miscanthus Rhizosphere | MVRTYWLVPVFNEASGNLDLQPFARTDHVEACRPRAMCTKCT |
| Ga0207690_1000106821 | 3300025932 | Corn Rhizosphere | MVRTYWFVTGFNEASVNLDLQPFARIDHVEACRPRAWIRI |
| Ga0207670_100895633 | 3300025936 | Switchgrass Rhizosphere | MVRTYWFLPGFNEASGNLDLQPFARTDHVEACRPRAM |
| Ga0207704_100001464 | 3300025938 | Miscanthus Rhizosphere | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAW |
| Ga0207689_118141781 | 3300025942 | Miscanthus Rhizosphere | MVRTYWLVPVFYEASGHLDLRPFARTDQIEACRPRAMCSSLYG |
| Ga0210068_10001082 | 3300025953 | Natural And Restored Wetlands | MVRTYWLLPVFYEASGHLDLQPFARTDRVEACRPRAMCSRLYGPRTAIRSRGL |
| Ga0208535_10006083 | 3300026045 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGHLDLQPFARTDHVEACRPRAM |
| Ga0208421_10010693 | 3300026058 | Natural And Restored Wetlands | MVRTYWLVPVFYEASGNLDLQPFARTDQIEACRPRAMWLPSVRRRVGWGK |
| Ga0207678_116590511 | 3300026067 | Corn Rhizosphere | MVRTYWFVTVFYEASVNLDLQPFARVDHVEACRPRV |
| Ga0207708_102596702 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRALRFEF |
| Ga0207702_1000060746 | 3300026078 | Corn Rhizosphere | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAPPF |
| Ga0207648_1000084811 | 3300026089 | Miscanthus Rhizosphere | MVRTYWLVPVFYEASGHLDLRPFARTDRVEACRPRAM |
| Ga0207674_104545843 | 3300026116 | Corn Rhizosphere | MVRTYWLVPVFHEASGHLDLQPFARTDQVEACRPRAMSALIVRF |
| Ga0209956_10091522 | 3300026127 | Soil | MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMWLPIVRGQVG |
| Ga0208996_10064991 | 3300027257 | Forest Soil | MVRTYWLVPGFNEASGNLDLQPFARVDHVEACRPHALMHLEL |
| Ga0209462_100000373 | 3300027761 | Agave | MVRTYWLVPVFYEASGHLDLQPFARTDRVEACRPRAMWVDCTV |
| Ga0209229_101956962 | 3300027805 | Freshwater And Sediment | MVRTYWFLPIFYEAIGTLDLQPSARTDRVEACRPLGWCPPILRDR |
| Ga0210366_100039893 | 3300028420 | Estuarine | MVRTSWLVPGFYEASGNLDLQSNARDNHVEAWRPRAMS |
| Ga0247818_109069012 | 3300028589 | Soil | MVRTYWFFPVFYEASGNLDLQPFARIDHVEACRPRAMCLQLYGVG |
| Ga0307291_10047862 | 3300028707 | Soil | MVRTYWLVPVFNEASGNLGLQPFARIDHVEACRPRAMCP |
| Ga0307303_101748191 | 3300028713 | Soil | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRACDAPPFYR |
| Ga0307315_100025821 | 3300028721 | Soil | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRAWNAL |
| Ga0307319_10000002199 | 3300028722 | Soil | MVRTYWFVLGFNEASSNLDLQPFARVDHVEACRPRAWNA |
| Ga0307297_101453151 | 3300028754 | Soil | MVRTYWFFPVFHEASGNLGLQPFARIDHVEACRPRAMYRRF |
| Ga0307280_101867621 | 3300028768 | Soil | MVRTYWFLPGFNEASGNLDLQPFARTDHVEACRPRAMWS |
| Ga0307288_100650721 | 3300028778 | Soil | MVRTYWLVPVFYEASGNLGLQPFARIDHVEACRPRAMCP |
| Ga0307282_100449972 | 3300028784 | Soil | MVRTYWLVPVFNEASGNLDLQPFARTDRVEACRPRAMSAPIVRC |
| Ga0307282_103173721 | 3300028784 | Soil | MVRTYWLVPVFNEASGNLDLQPFARTDHVEACRPRAMWTDCTR |
| Ga0307282_104712751 | 3300028784 | Soil | LMVRTYWLVPVFNEASGNLDLQPFARIDQIETCRPRAMS |
| Ga0265338_111212971 | 3300028800 | Rhizosphere | EGELMVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRAGCI |
| Ga0307503_108539571 | 3300028802 | Soil | MVRTYWFVPGFNEASGNLDLQPFARIDHVEACRPRADCLNCT |
| Ga0307314_100066933 | 3300028872 | Soil | MVRTYWFVTGFNEASVNLGLQPFARVDHVEACRPRAWFRP |
| Ga0307289_102314942 | 3300028875 | Soil | MVRTYWLVPVFYEASGNLDLQPFARVDHVEACRPRAMCIRLYGAGYVAGL |
| Ga0311340_113573441 | 3300029943 | Palsa | MVRTYWFVSGFNEASDNLDLQPLARIDHVEACRPRGEMHLK |
| Ga0307511_100632862 | 3300030521 | Ectomycorrhiza | MVRTYWLVPGFNEASDNLDLRPFARIDQIEACRPRAMCHRLYGVADAGARI |
| Ga0307499_100020296 | 3300031184 | Soil | MVRTYWLVPVFYEASGNLDLRPFARTDQIEACRPRAMWLPIVRRRVRCDS |
| Ga0307496_100039854 | 3300031200 | Soil | MVRTYWFLPGFNEASGNLDLQPFARTDHVEACRPRAYVQRLYGVG |
| Ga0299914_1000000597 | 3300031228 | Soil | MVRTYWLVPVFYEASGHLDLQPFARIDQVEACRPRAM |
| Ga0299914_112984391 | 3300031228 | Soil | ESELMVRTYWLVPVFYEASGNLDLQPVRTIDHVEACRPRAMCS |
| Ga0299914_113128151 | 3300031228 | Soil | MVRTYWLVPVFYEASGNLDLQPVRTIDHVEACRPRAMWT |
| Ga0299913_100643006 | 3300031229 | Soil | MVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPHAMCVPLYAAG |
| Ga0315297_100844782 | 3300031873 | Sediment | MVRTYWFFPGFYEASGNLGLQPFALTTTSKPCRPRAMSHSIVRCEWV |
| Ga0316583_100168622 | 3300032133 | Rhizosphere | MVRTYWLVPVFYEASGHLDLRPFARIDQIEACRPRAMWLPIVRRRVG |
| Ga0307470_100083934 | 3300032174 | Hardwood Forest Soil | MVRTYWLVPVFNEASGHLDLQPFARIDRVEACRPRAMCSDCTV |
| Ga0307472_1000895163 | 3300032205 | Hardwood Forest Soil | MVRTYWLVPGFNEASGNLDLQPFARIDQIEACRPRAMCPPIVR |
| Ga0335085_1001894010 | 3300032770 | Soil | MVRTYWLVPVFNEASGNLDLQPFARTDHVEACRPRAM |
| Ga0334905_002025_1675_1812 | 3300034687 | Soil | MVRTYWLVPVFYEASGNLDLQPFARTDQVEACRPRAMCFRLYGVG |
| ⦗Top⦘ |