| Basic Information | |
|---|---|
| Family ID | F065229 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MLLIRFAISIFALTLLGLAISLSVAQSEQETNAAQAATLIHQ |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 47.24 % |
| % of genes near scaffold ends (potentially truncated) | 46.09 % |
| % of genes from short scaffolds (< 2000 bps) | 85.94 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.438 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil (11.719 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.125 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.312 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01575 | MaoC_dehydratas | 39.06 |
| PF07690 | MFS_1 | 13.28 |
| PF06568 | DUF1127 | 3.91 |
| PF13356 | Arm-DNA-bind_3 | 1.56 |
| PF02798 | GST_N | 1.56 |
| PF01134 | GIDA | 0.78 |
| PF00873 | ACR_tran | 0.78 |
| PF00160 | Pro_isomerase | 0.78 |
| PF13442 | Cytochrome_CBB3 | 0.78 |
| PF14542 | Acetyltransf_CG | 0.78 |
| PF02699 | YajC | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 3.91 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG1862 | Protein translocase subunit YajC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.44 % |
| Unclassified | root | N/A | 1.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0935276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1148 | Open in IMG/M |
| 3300000953|JGI11615J12901_12561410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. | 539 | Open in IMG/M |
| 3300001430|JGI24032J14994_102783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 609 | Open in IMG/M |
| 3300001433|JGI24036J14985_100235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2641 | Open in IMG/M |
| 3300002075|JGI24738J21930_10053810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
| 3300002128|JGI24036J26619_10001083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4825 | Open in IMG/M |
| 3300002820|JGI25490J38602_10161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 551 | Open in IMG/M |
| 3300003994|Ga0055435_10152712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 644 | Open in IMG/M |
| 3300003995|Ga0055438_10020236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1501 | Open in IMG/M |
| 3300004114|Ga0062593_101048938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 841 | Open in IMG/M |
| 3300004114|Ga0062593_103279246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300004156|Ga0062589_100092485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1892 | Open in IMG/M |
| 3300004156|Ga0062589_101201150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 726 | Open in IMG/M |
| 3300004157|Ga0062590_100453897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 1074 | Open in IMG/M |
| 3300004157|Ga0062590_100688944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 918 | Open in IMG/M |
| 3300005093|Ga0062594_101644311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 668 | Open in IMG/M |
| 3300005103|Ga0066813_1010062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300005146|Ga0066817_1036716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 507 | Open in IMG/M |
| 3300005168|Ga0066809_10103151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 700 | Open in IMG/M |
| 3300005204|Ga0068997_10031173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 941 | Open in IMG/M |
| 3300005290|Ga0065712_10365121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 770 | Open in IMG/M |
| 3300005293|Ga0065715_10343555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 961 | Open in IMG/M |
| 3300005329|Ga0070683_101804915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 588 | Open in IMG/M |
| 3300005330|Ga0070690_100233189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1295 | Open in IMG/M |
| 3300005331|Ga0070670_100200704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1733 | Open in IMG/M |
| 3300005332|Ga0066388_100899210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 1464 | Open in IMG/M |
| 3300005332|Ga0066388_102832753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 886 | Open in IMG/M |
| 3300005332|Ga0066388_108551319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 509 | Open in IMG/M |
| 3300005334|Ga0068869_100826723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 798 | Open in IMG/M |
| 3300005337|Ga0070682_100173843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1499 | Open in IMG/M |
| 3300005339|Ga0070660_101846482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 515 | Open in IMG/M |
| 3300005344|Ga0070661_101050872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 677 | Open in IMG/M |
| 3300005367|Ga0070667_100730727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 917 | Open in IMG/M |
| 3300005406|Ga0070703_10028628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1667 | Open in IMG/M |
| 3300005455|Ga0070663_100239746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 1431 | Open in IMG/M |
| 3300005455|Ga0070663_100921148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 756 | Open in IMG/M |
| 3300005456|Ga0070678_101061959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 746 | Open in IMG/M |
| 3300005458|Ga0070681_10637877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 980 | Open in IMG/M |
| 3300005518|Ga0070699_100891042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 815 | Open in IMG/M |
| 3300005545|Ga0070695_100004677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 8050 | Open in IMG/M |
| 3300005713|Ga0066905_101407667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300005764|Ga0066903_101803821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1169 | Open in IMG/M |
| 3300005764|Ga0066903_102138914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1078 | Open in IMG/M |
| 3300005834|Ga0068851_10229975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1045 | Open in IMG/M |
| 3300005937|Ga0081455_10000036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 136303 | Open in IMG/M |
| 3300006042|Ga0075368_10317701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 674 | Open in IMG/M |
| 3300006577|Ga0074050_11904236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1457 | Open in IMG/M |
| 3300006806|Ga0079220_10751980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
| 3300006845|Ga0075421_101909507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300006854|Ga0075425_100455759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1473 | Open in IMG/M |
| 3300006903|Ga0075426_10514542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 890 | Open in IMG/M |
| 3300006954|Ga0079219_10234344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1076 | Open in IMG/M |
| 3300009036|Ga0105244_10042143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2362 | Open in IMG/M |
| 3300009094|Ga0111539_10087975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3650 | Open in IMG/M |
| 3300009162|Ga0075423_10260841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1815 | Open in IMG/M |
| 3300009802|Ga0105073_1066598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 512 | Open in IMG/M |
| 3300010047|Ga0126382_10022730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3299 | Open in IMG/M |
| 3300010047|Ga0126382_10900494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300010371|Ga0134125_10368217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1594 | Open in IMG/M |
| 3300010371|Ga0134125_12511662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 560 | Open in IMG/M |
| 3300010396|Ga0134126_12289214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
| 3300010401|Ga0134121_10673020 | Not Available | 978 | Open in IMG/M |
| 3300011119|Ga0105246_11057048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 739 | Open in IMG/M |
| 3300012506|Ga0157324_1055230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 528 | Open in IMG/M |
| 3300012509|Ga0157334_1054409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 561 | Open in IMG/M |
| 3300012511|Ga0157332_1017869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 795 | Open in IMG/M |
| 3300012899|Ga0157299_10008450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1684 | Open in IMG/M |
| 3300012902|Ga0157291_10070467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 881 | Open in IMG/M |
| 3300012903|Ga0157289_10377959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 526 | Open in IMG/M |
| 3300012913|Ga0157298_10011946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1473 | Open in IMG/M |
| 3300012960|Ga0164301_10009204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3891 | Open in IMG/M |
| 3300015372|Ga0132256_103111276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300015373|Ga0132257_100613040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1346 | Open in IMG/M |
| 3300015373|Ga0132257_101705851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 808 | Open in IMG/M |
| 3300019356|Ga0173481_10000306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9878 | Open in IMG/M |
| 3300019356|Ga0173481_10428229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 655 | Open in IMG/M |
| 3300019361|Ga0173482_10000041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 18943 | Open in IMG/M |
| 3300019361|Ga0173482_10023545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1780 | Open in IMG/M |
| 3300022886|Ga0247746_1011677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1821 | Open in IMG/M |
| 3300022901|Ga0247788_1002026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3124 | Open in IMG/M |
| 3300023071|Ga0247752_1000248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5960 | Open in IMG/M |
| 3300023168|Ga0247748_1011853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1158 | Open in IMG/M |
| 3300025315|Ga0207697_10206759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 864 | Open in IMG/M |
| 3300025321|Ga0207656_10165666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1054 | Open in IMG/M |
| 3300025538|Ga0210132_1004972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1711 | Open in IMG/M |
| 3300025901|Ga0207688_10214815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1157 | Open in IMG/M |
| 3300025903|Ga0207680_10063638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2258 | Open in IMG/M |
| 3300025910|Ga0207684_11687665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 511 | Open in IMG/M |
| 3300025912|Ga0207707_10603948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 928 | Open in IMG/M |
| 3300025912|Ga0207707_10668929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 874 | Open in IMG/M |
| 3300025914|Ga0207671_10212915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1512 | Open in IMG/M |
| 3300025917|Ga0207660_10591846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 903 | Open in IMG/M |
| 3300025921|Ga0207652_11091677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 698 | Open in IMG/M |
| 3300025924|Ga0207694_10218028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1556 | Open in IMG/M |
| 3300025932|Ga0207690_10457617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1026 | Open in IMG/M |
| 3300025932|Ga0207690_10884886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300025961|Ga0207712_10000473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 33877 | Open in IMG/M |
| 3300025961|Ga0207712_10951766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 761 | Open in IMG/M |
| 3300025965|Ga0210090_1059403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300026733|Ga0207550_102485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 584 | Open in IMG/M |
| 3300026772|Ga0207596_104329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
| 3300026793|Ga0207441_101175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 934 | Open in IMG/M |
| 3300026841|Ga0207490_1000594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1298 | Open in IMG/M |
| 3300026952|Ga0207434_1011691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 695 | Open in IMG/M |
| 3300026995|Ga0208761_1000802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1615 | Open in IMG/M |
| 3300027401|Ga0208637_1012225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 885 | Open in IMG/M |
| 3300027424|Ga0209984_1023580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 850 | Open in IMG/M |
| 3300027437|Ga0207476_107285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 548 | Open in IMG/M |
| 3300027482|Ga0207460_104401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 531 | Open in IMG/M |
| 3300027560|Ga0207981_1001436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4265 | Open in IMG/M |
| 3300027617|Ga0210002_1078325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300027765|Ga0209073_10030315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1670 | Open in IMG/M |
| 3300027876|Ga0209974_10033812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1697 | Open in IMG/M |
| 3300027876|Ga0209974_10090638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1060 | Open in IMG/M |
| 3300027907|Ga0207428_10257848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1299 | Open in IMG/M |
| 3300028381|Ga0268264_11154351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 784 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1009409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1962 | Open in IMG/M |
| 3300031740|Ga0307468_102159656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300031940|Ga0310901_10105786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1023 | Open in IMG/M |
| 3300032000|Ga0310903_10658517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 562 | Open in IMG/M |
| 3300032144|Ga0315910_10220808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1426 | Open in IMG/M |
| 3300032174|Ga0307470_10187558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1308 | Open in IMG/M |
| 3300032205|Ga0307472_100592875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 976 | Open in IMG/M |
| 3300032211|Ga0310896_10021160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2311 | Open in IMG/M |
| 3300033004|Ga0335084_10323838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1591 | Open in IMG/M |
| 3300033412|Ga0310810_10212536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 2171 | Open in IMG/M |
| 3300033475|Ga0310811_11365018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 552 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 11.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.47% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.69% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.12% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.12% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.78% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Environmental | Open in IMG/M |
| 3300001433 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002820 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005103 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA | Environmental | Open in IMG/M |
| 3300005146 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAB | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026733 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026772 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026793 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A3a-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026841 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A3a-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026952 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027437 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027482 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A2w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031825 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_09352762 | 2228664021 | Soil | MLLIRLAISVFALMLLGLAVSLSTAQSEQETNAAKNATPAATFIHQ |
| JGI11615J12901_125614102 | 3300000953 | Soil | MAFYIVAMDASAMLLIRFAISIFALTLLGLALSLSAAQSELETNAAKAATLIHQ* |
| JGI24032J14994_1027831 | 3300001430 | Corn, Switchgrass And Miscanthus Rhizosphere | LVQWLSGLSAIILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ* |
| JGI24036J14985_1002355 | 3300001433 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIRFAISGFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ* |
| JGI24738J21930_100538102 | 3300002075 | Corn Rhizosphere | MLLIRFAISIFALTLLGLAISXSVAQSEQEASAAKAATLTHQ* |
| JGI24036J26619_100010839 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIRFAISIFALTLLGLAISLSVAQSEQXXXAAXAAXLXHQ* |
| JGI25490J38602_101612 | 3300002820 | Soil | LSAIILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ* |
| Ga0055435_101527122 | 3300003994 | Natural And Restored Wetlands | MLLIRFAISIFALTLLGLAVSLSAAQSEQGTAAAKEATFIHQ* |
| Ga0055438_100202362 | 3300003995 | Natural And Restored Wetlands | MLLIRFAISIFALTLLGLAVSLSAAQSEQETAAAKEATLAATLIHQ* |
| Ga0062593_1010489381 | 3300004114 | Soil | MLLIRFAISIFALTLLGLAISLSAAQSEQETTAAKDATVAATLIHQ* |
| Ga0062593_1032792462 | 3300004114 | Soil | LFNGFLGFLQSFSDAIPAMMLIRFAISIFALTLLGLAISLSAAQSEQETNPARAATFIHQ |
| Ga0062589_1000924852 | 3300004156 | Soil | MMLIRFAISIFALTLLGLAISLSAAQSEQETNPARAATFIHQ* |
| Ga0062589_1012011502 | 3300004156 | Soil | MLLIRFAISIFALMLLGLAVSLSTAQSEQEIHAATAATFTHQ* |
| Ga0062590_1004538972 | 3300004157 | Soil | MLLIRFAISIFALMLLGLAVSLSTAQSEQEIHAAKDATLAATFIHQ* |
| Ga0062590_1006889442 | 3300004157 | Soil | AMLLIRLAISIFALMLLGLAVSLSTAQSEQESSAVPTATFIHQ* |
| Ga0062594_1016443112 | 3300005093 | Soil | MLLIRLAISIFALMLLGLAVSLSTAQSEPESSAAPTATFIHQ* |
| Ga0066813_10100622 | 3300005103 | Soil | MLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLIHQ* |
| Ga0066817_10367162 | 3300005146 | Soil | GLSAIVLSDAIPAMLLIRFAISIFALMLLGLAVSMSVAQSEQETNAAQAATLIHQ* |
| Ga0066809_101031512 | 3300005168 | Soil | FSALSAIILSDAIPAMLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLIHQ* |
| Ga0068997_100311731 | 3300005204 | Natural And Restored Wetlands | VLLIRFAISIFALTLLGLAISLSAAQSDQETAAAKDATLEATLIHQ* |
| Ga0065712_103651212 | 3300005290 | Miscanthus Rhizosphere | MLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ* |
| Ga0065715_103435551 | 3300005293 | Miscanthus Rhizosphere | ALSAIILSDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIHQ* |
| Ga0070683_1018049151 | 3300005329 | Corn Rhizosphere | AIPAMMLIRFAISIFALTLLGLAISLSAAQSEQETNPARAATFIHQ* |
| Ga0070690_1002331891 | 3300005330 | Switchgrass Rhizosphere | MLLIRLAISIFALMLLGLAVSLSTAQSEQESSAAPTATFIHQ* |
| Ga0070670_1002007041 | 3300005331 | Switchgrass Rhizosphere | AMMLIRFAISIFALTLLGLAISLSAAQSEQETNPARAATFIHQ* |
| Ga0066388_1008992102 | 3300005332 | Tropical Forest Soil | MLLIRFAISIFALTLLGLAISLSVAQSEQETDSAQAETLIHQ* |
| Ga0066388_1028327531 | 3300005332 | Tropical Forest Soil | PAMLLIRFAISIFALTLLGLAISLSVAQSKQETDAAATLIHQ* |
| Ga0066388_1085513192 | 3300005332 | Tropical Forest Soil | MLLIRFAISIFALTLLGLAVSLSIAQSELETNPVQAETLIHQ* |
| Ga0068869_1008267232 | 3300005334 | Miscanthus Rhizosphere | MLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIHQ* |
| Ga0070682_1001738431 | 3300005337 | Corn Rhizosphere | MLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLT |
| Ga0070660_1018464821 | 3300005339 | Corn Rhizosphere | HRLVQRRSTIILSDAIPVMLLIRFAISIFALTLLGLAVSLSVAQSEQETNAAAAATFIQQ |
| Ga0070661_1010508721 | 3300005344 | Corn Rhizosphere | AMLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLTHQ* |
| Ga0070667_1007307271 | 3300005367 | Switchgrass Rhizosphere | GLSAIILSDAIPAMMLIRFAISIFALTLLGLAISLSAAQSEQETNPARAATFIHQ* |
| Ga0070703_100286282 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | GFGLSAIILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ* |
| Ga0070663_1002397462 | 3300005455 | Corn Rhizosphere | MLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLTHQ* |
| Ga0070663_1009211481 | 3300005455 | Corn Rhizosphere | VMLLIRFAISIFALTLLGLAVSLSVAQSEQETNAAAAATFIQQ* |
| Ga0070678_1010619592 | 3300005456 | Miscanthus Rhizosphere | GLSAIILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ* |
| Ga0070681_106378772 | 3300005458 | Corn Rhizosphere | MLLIRFAISIFALTLLGLAVSLSVAQSEQETNAAAAATFIQQ* |
| Ga0070699_1008910422 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIRLAISIFALMLLGLAVSLSTAQSEQESSAVPTATFIHQ* |
| Ga0070695_1000046771 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ* |
| Ga0066905_1014076671 | 3300005713 | Tropical Forest Soil | MLLIRFAISIFALTLLGLAVSLSIAQGELETNPAQAETLIHQ* |
| Ga0066903_1018038212 | 3300005764 | Tropical Forest Soil | MLLIRLAISIFALTLFGFAISLGSAQSENGPAAAAAIVSPR* |
| Ga0066903_1021389142 | 3300005764 | Tropical Forest Soil | MLLIRFAISIFALTLLGLAISLSVAQSDQETEAAATLIHQ* |
| Ga0068851_102299752 | 3300005834 | Corn Rhizosphere | LIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ* |
| Ga0081455_1000003634 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLLIRFAISVFALTLLGLAVSLSIAQSELETNPAQAETLIHQ* |
| Ga0075368_103177012 | 3300006042 | Populus Endosphere | AIILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ* |
| Ga0074050_119042361 | 3300006577 | Soil | MLLIRLAISIFALMLLGLAVSLSAAQSEQETNAAPAAAFIHQ* |
| Ga0079220_107519802 | 3300006806 | Agricultural Soil | MMLIRFAISIFALMLLALAISLSAAQSEQETNAVKATTLIHH* |
| Ga0075421_1019095071 | 3300006845 | Populus Rhizosphere | MLLIRLAISVFALMLLGLAVSLSTAQSEQETNAAKNATPAATFIHQ* |
| Ga0075425_1004557592 | 3300006854 | Populus Rhizosphere | MLLIRFAISVFALTLLGLAISLSVAQSEQETDAVNAATLIRQ* |
| Ga0075426_105145421 | 3300006903 | Populus Rhizosphere | TIILSDAIPVMLLIRFAISVFALTLLGLAISLSVAQSEQETDAVNAATLIRQ* |
| Ga0079219_102343443 | 3300006954 | Agricultural Soil | MMLIRFAISIFALMLLALAISLSAAQSEQETNAVKAT |
| Ga0105244_100421432 | 3300009036 | Miscanthus Rhizosphere | LFNGFGLSAIILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ |
| Ga0111539_100879752 | 3300009094 | Populus Rhizosphere | MAFYIVAMDAPAMLLIRFAISIFALTLLGLALSLSAAQSELETNAAKAATLIHQ* |
| Ga0075423_102608411 | 3300009162 | Populus Rhizosphere | QWFSALSAIILSDTIPAMLLIRFAISIFALTLLGIAISLSVAQSEQEASAAKAATLTHQ* |
| Ga0105073_10665982 | 3300009802 | Groundwater Sand | MLLIRLAISVFALMLLGLAVSLSTAQSEQETNAARTATFIHQ* |
| Ga0126382_100227302 | 3300010047 | Tropical Forest Soil | MPAMLLIRFAISIFALTLLGLAVSLSIAQGELETNPAQAETLIHQ* |
| Ga0126382_109004941 | 3300010047 | Tropical Forest Soil | MLLIRFAISVFALTLLGLAISLSVAQSEQETDAVKAAALIRQ* |
| Ga0134125_103682172 | 3300010371 | Terrestrial Soil | MMLMRFAISIFALTQLGLAISLSAAQSEQEIAAVQAAELIHH* |
| Ga0134125_125116622 | 3300010371 | Terrestrial Soil | MLLIRLAISIFALMLLGLAVSLSTAQSEQEIHAATAATFTHQ* |
| Ga0134126_122892142 | 3300010396 | Terrestrial Soil | MMLMRFAISIFALTLLGLAISLSAAQSEQEIAAVQAAELIHH* |
| Ga0134121_106730201 | 3300010401 | Terrestrial Soil | IILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNTAQAATFIHQ* |
| Ga0105246_110570482 | 3300011119 | Miscanthus Rhizosphere | FGLSAIILSDAIPAMMLIRFAISIFALTLLGLAISLSAAQSEQETNPARAATFIHQ* |
| Ga0157324_10552302 | 3300012506 | Arabidopsis Rhizosphere | SALSAIILSDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLTHQ* |
| Ga0157334_10544092 | 3300012509 | Soil | LLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLTHQ* |
| Ga0157332_10178691 | 3300012511 | Soil | DTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLTHQ* |
| Ga0157299_100084502 | 3300012899 | Soil | FSALSAIILSDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIHQ* |
| Ga0157291_100704672 | 3300012902 | Soil | SAIILSDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIHQ* |
| Ga0157289_103779591 | 3300012903 | Soil | NGFLGFLQSFSDAIPAMMLIRFAISIFALTLLGLAISLSAAQSEQEASAAKAATLTHQ* |
| Ga0157298_100119462 | 3300012913 | Soil | WFSALSAIILSDTIPAILLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIHQ* |
| Ga0164301_100092045 | 3300012960 | Soil | MLLIRFAISVFALMLLGLAVSLSVAQSEDETNTAQAATFIHQ* |
| Ga0132256_1031112762 | 3300015372 | Arabidopsis Rhizosphere | MLLIRFAISIFALTLLGLAISLSAAQSEQETNAAKDATLAAPLIHQ* |
| Ga0132257_1006130402 | 3300015373 | Arabidopsis Rhizosphere | MLLIRFAISVFALMLLGLAVSLSVAQSEDETNIAQAATFIHQ* |
| Ga0132257_1017058512 | 3300015373 | Arabidopsis Rhizosphere | MLLIRFAISIFALMLLGLAVSMSVAQSEQETNAAQAATLIHQ* |
| Ga0173481_100003062 | 3300019356 | Soil | MLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ |
| Ga0173481_104282292 | 3300019356 | Soil | MLLIRFAISIFALTLLGLAISLSAAQSEQETTAAKDATVAATLIHQ |
| Ga0173482_100000411 | 3300019361 | Soil | MLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQ |
| Ga0173482_100235453 | 3300019361 | Soil | DAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ |
| Ga0247746_10116771 | 3300022886 | Soil | WFSALSAIILSDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIHQ |
| Ga0247788_10020262 | 3300022901 | Soil | MLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIHQ |
| Ga0247752_10002485 | 3300023071 | Soil | MLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLTHQ |
| Ga0247748_10118532 | 3300023168 | Soil | LVQWLSGLSAIILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIH |
| Ga0207697_102067592 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MMLIRFAISIFALTLLGLAISLSAAQSEQETNPARAATFIHQ |
| Ga0207656_101656661 | 3300025321 | Corn Rhizosphere | IRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ |
| Ga0210132_10049722 | 3300025538 | Natural And Restored Wetlands | MLLIRFAISIFALTLLGLAVSLSAAQSEQETAAAKEATLAATLIHQ |
| Ga0207688_102148152 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | AIILSDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLTHQ |
| Ga0207680_100636381 | 3300025903 | Switchgrass Rhizosphere | SGLSAIILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ |
| Ga0207684_116876652 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ |
| Ga0207707_106039482 | 3300025912 | Corn Rhizosphere | IRLAISIFALMLLGLAVSLSTAQSEPESSAAPTATFIHQ |
| Ga0207707_106689292 | 3300025912 | Corn Rhizosphere | MLLIRFAISIFALTLLGLAVSLSVAQSEQETNAAAAATFIQQ |
| Ga0207671_102129152 | 3300025914 | Corn Rhizosphere | RLVQWLSGLSAIILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ |
| Ga0207660_105918462 | 3300025917 | Corn Rhizosphere | MLLIRLAISIFALMLLGLAVSLSTAQSEPESSAAPTATFIHQ |
| Ga0207652_110916772 | 3300025921 | Corn Rhizosphere | LSAIILSDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIHQ |
| Ga0207694_102180281 | 3300025924 | Corn Rhizosphere | IILSYAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ |
| Ga0207690_104576172 | 3300025932 | Corn Rhizosphere | LSAIILSDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLTHQ |
| Ga0207690_108848861 | 3300025932 | Corn Rhizosphere | MLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIH |
| Ga0207712_1000047321 | 3300025961 | Switchgrass Rhizosphere | MLLIRFAISVFALMLLGLAVSLSVAQSEDETNTAQAATFIHQ |
| Ga0207712_109517662 | 3300025961 | Switchgrass Rhizosphere | SDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLTHQ |
| Ga0210090_10594032 | 3300025965 | Natural And Restored Wetlands | MLLIRFAISIFALTLLGLAISLSAAQSEQETNAAPAATL |
| Ga0207550_1024852 | 3300026733 | Soil | TIPAMLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIHQ |
| Ga0207596_1043291 | 3300026772 | Soil | MLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAA |
| Ga0207441_1011752 | 3300026793 | Soil | MLLIRFAISIFALMLLGLAVSLSTAQSEQEIHAATAATFTHQ |
| Ga0207490_10005941 | 3300026841 | Soil | FNGFGLSAIILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ |
| Ga0207434_10116912 | 3300026952 | Soil | MLLIRFAISVFALMLLGLAVSLSTAQSEQEIHAATAATFTHQ |
| Ga0208761_10008022 | 3300026995 | Soil | MLLIRFAISIFALTLLGLAISLSVAQSEQETNAAQAATLIHQ |
| Ga0208637_10122252 | 3300027401 | Soil | MLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLIHQ |
| Ga0209984_10235802 | 3300027424 | Arabidopsis Thaliana Rhizosphere | LFNGFGLSAIILSDAIPAMLLIRFAISVFALMLLGLAVSLSTAQSEQETNAAKNATPAATFIHQ |
| Ga0207476_1072852 | 3300027437 | Soil | LLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLTHQ |
| Ga0207460_1044012 | 3300027482 | Soil | AIILSDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIHQ |
| Ga0207981_10014362 | 3300027560 | Soil | MLLIRFAISIFALMLLGLAVSMSVAQSEQETNAAQAATLIHQ |
| Ga0210002_10783252 | 3300027617 | Arabidopsis Thaliana Rhizosphere | MLLIRLAISVFALMLLGLAVSLSTAQSEQETNAAKNA |
| Ga0209073_100303152 | 3300027765 | Agricultural Soil | MLLIRFAIGIFALALLGLAISLSAAQSEAETDAVTATPLIHQ |
| Ga0209974_100338122 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MLLIRFAISVFALMLLGLAISLSAAQSEQETNPAQAATLIHQ |
| Ga0209974_100906381 | 3300027876 | Arabidopsis Thaliana Rhizosphere | IILSDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQETNAARAAALIHQ |
| Ga0207428_102578482 | 3300027907 | Populus Rhizosphere | MAFYIVAMDAPAMLLIRFAISIFALTLLGLALSLSAAQSELEANAAKAATLIHQ |
| Ga0268264_111543511 | 3300028381 | Switchgrass Rhizosphere | RLVQWLFGLSAIILSDAIPAMMLIRFAISIFALTLLGLAISLSAAQSEQETNPARAATFIHQ |
| (restricted) Ga0255311_10094092 | 3300031150 | Sandy Soil | MLLIRLAISVFALMLLGLAVSLSTAQSEQETNAARTATFIHQ |
| Ga0307468_1021596562 | 3300031740 | Hardwood Forest Soil | MLLIRFAISIFALTLLGLAVSLSIAQSELETNPAQAETLIHQ |
| (restricted) Ga0255338_10100208 | 3300031825 | Sandy Soil | MILMRFAISIFALALLGLALSLSSAQSKQDNAVDVAAVTIR |
| Ga0310901_101057862 | 3300031940 | Soil | MLLIRFAISIFALMLLGLAVSMNVAQSEQETNAAQAATLIHQ |
| Ga0310903_106585172 | 3300032000 | Soil | MVFWLSAIVLSDAIPAMLLIRFAISIFALMLLGLAVSMSVAQSEQETNAAQAATLIHQ |
| Ga0315910_102208082 | 3300032144 | Soil | MLLIRLAISVFALMLLGLAVSLSTAQSGQETNAARTATFTHQ |
| Ga0307470_101875582 | 3300032174 | Hardwood Forest Soil | MLLIRFAISIFALTLLGLAVSLSIAQSELETNPAQAGTLIHQ |
| Ga0307472_1005928752 | 3300032205 | Hardwood Forest Soil | LVQRLSTIILSDAILAMLLIRFAISIFALTLLGLAVSLSIAQSELETNPAQAETLIHQ |
| Ga0310896_100211604 | 3300032211 | Soil | FSAIILSDTIPAMLLIRFAISIFALTLLGLAISLSVAQSEQEASAAKAATLTHQ |
| Ga0335084_103238381 | 3300033004 | Soil | MLLIRFAISVLALMLLGLAISLSAAQSEQETTAAKDATVAATLIHQ |
| Ga0310810_102125362 | 3300033412 | Soil | MLLIRLAISIFALTLLGLAISLSAAQSEHATAAKDATLAATLIHQ |
| Ga0310811_113650182 | 3300033475 | Soil | RLVQRRSTIILSDAIPVMLLIRFAISIFALTLLGLAVSLSVAQSEQETNAAAAATFIQQ |
| ⦗Top⦘ |