| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002529 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053054 | Gp0056899 | Ga0005057 |
| Sample Name | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank highO2_0.2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 940025225 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 6 |
| Associated Families | 6 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_55_13 | 1 |
| All Organisms → cellular organisms → Archaea | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. PtaB.Bin001 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Rifle, Colorado, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → land → soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Rifle, Colorado, United States | |||||||
| Coordinates | Lat. (o) | 39.534762 | Long. (o) | -107.782602 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017881 | Metagenome / Metatranscriptome | 238 | Y |
| F035129 | Metagenome / Metatranscriptome | 173 | Y |
| F047211 | Metagenome | 150 | Y |
| F065251 | Metagenome / Metatranscriptome | 128 | Y |
| F082441 | Metagenome | 113 | Y |
| F096818 | Metagenome | 104 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C687J35504_10088301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_55_13 | 1398 | Open in IMG/M |
| C687J35504_10093091 | All Organisms → cellular organisms → Archaea | 1350 | Open in IMG/M |
| C687J35504_10158984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 949 | Open in IMG/M |
| C687J35504_10190330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 845 | Open in IMG/M |
| C687J35504_10245990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. PtaB.Bin001 | 717 | Open in IMG/M |
| C687J35504_10272383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 673 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C687J35504_10088301 | C687J35504_100883011 | F096818 | AGRAAANRTIYPRGWPTFGATEARTWGPSRSIYWAKILFEKWWLWRYF* |
| C687J35504_10093091 | C687J35504_100930911 | F065251 | MYLRHFIKGNKKYYYIAKAVRKGVRVIQKSVLYIGTADTLYGKLVSLKKK* |
| C687J35504_10158984 | C687J35504_101589842 | F047211 | LDHAYEGMRARATVDLIPPEAAVENLVKMVTYVDKRAATIDRSKLADYSILKELAQSKQIPAKK* |
| C687J35504_10190330 | C687J35504_101903302 | F082441 | KEEEKHHEKGNIHRRAFFFLAMSVDQGVAQAGEVTIGPDLKIPPHYRPGKSCSPGRGYNASAEAPNYPSTYPKMNLRVFNGEVIGFLFELDAKEGWKPWYDQPEGKPTTHEGGEPHYTQTIYIKKGPTAEECKVSKSPYGQ* |
| C687J35504_10245990 | C687J35504_102459902 | F035129 | MKKILFCFLICVIPSTVFAASFPQSIAFEFQEHGKFTGIIGKAYITETAVEIVTFAEKSGEVVPFAFICTILEKRSQIEGLYNIKCRNQIGVVSTGTIDIRDPLKPKMTLTSDKGITITNISDGGRKMKKEFLPKLDLGK* |
| C687J35504_10272383 | C687J35504_102723831 | F017881 | VALFFHSDDVDHLISLKEAVAIAESALKDIPLRAGVNAPRKRLNLHRNGGEYPYDTVLNVYAGGSASYGAIGAQVALHRKAIQGTVQKRPPFNPDQTELALIYDVDSGSLLGVMAHRPRHVQGVADLRTPATSLAGLDLFARADAKKVGIY |
| ⦗Top⦘ |