NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F100776

Metagenome Family F100776

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100776
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 192 residues
Representative Sequence NPLSDYIHFDPIGLLLTSVQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRQSEVIPGGIYPATPKSGKPLSEGFYEVKTATLSQEVLPFAQKVQEIGQIVSGALPSLFGGQTAGSRTASEYSMSRAQALQRLQTTWKMLTMWWKQIFGKIIPMYIKEMKDDEKQVKRDEFGNFVNVFIR
Number of Associated Samples 93
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 90.20 %
% of genes from short scaffolds (< 2000 bps) 90.20 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.196 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(13.725 % of family members)
Environment Ontology (ENVO) Unclassified
(35.294 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(31.373 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.82%    β-sheet: 7.58%    Coil/Unstructured: 43.60%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.20 %
UnclassifiedrootN/A9.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c1705918All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium554Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_12999518All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis514Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_13254275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium554Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1058320All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium513Open in IMG/M
3300000787|JGI11643J11755_10553230All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M
3300000955|JGI1027J12803_100988142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis511Open in IMG/M
3300001133|C687J13250_103082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis578Open in IMG/M
3300004050|Ga0055491_10173359All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis575Open in IMG/M
3300004481|Ga0069718_14892926All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium541Open in IMG/M
3300005093|Ga0062594_102655978All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium553Open in IMG/M
3300005294|Ga0065705_11065287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium531Open in IMG/M
3300005294|Ga0065705_11142242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis513Open in IMG/M
3300006796|Ga0066665_11459672All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium532Open in IMG/M
3300006854|Ga0075425_102194942All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium615Open in IMG/M
3300006881|Ga0068865_101167735All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium680Open in IMG/M
3300006881|Ga0068865_101760866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium559Open in IMG/M
3300006930|Ga0079303_10304360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis659Open in IMG/M
3300006969|Ga0075419_11071820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis589Open in IMG/M
3300006969|Ga0075419_11170162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis566Open in IMG/M
3300009037|Ga0105093_10511418All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium670Open in IMG/M
3300009087|Ga0105107_10816440All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300009094|Ga0111539_12959232All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium549Open in IMG/M
3300009167|Ga0113563_12522785All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium620Open in IMG/M
3300009553|Ga0105249_11707811All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium702Open in IMG/M
3300009610|Ga0105340_1325786All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium675Open in IMG/M
3300010047|Ga0126382_10930013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium755Open in IMG/M
3300010359|Ga0126376_12514871All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium563Open in IMG/M
3300010366|Ga0126379_12425807All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium624Open in IMG/M
3300010400|Ga0134122_12557853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium560Open in IMG/M
3300010403|Ga0134123_13526201All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300011415|Ga0137325_1078389All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium731Open in IMG/M
3300011430|Ga0137423_1250848All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium523Open in IMG/M
3300011431|Ga0137438_1156295All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium700Open in IMG/M
3300011435|Ga0137426_1242704All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium538Open in IMG/M
3300011438|Ga0137451_1162336All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium702Open in IMG/M
3300011445|Ga0137427_10486070All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300012038|Ga0137431_1155248All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium654Open in IMG/M
3300012166|Ga0137350_1100621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium586Open in IMG/M
3300012672|Ga0137317_1034485All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M
3300012895|Ga0157309_10287664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium550Open in IMG/M
3300012900|Ga0157292_10405794All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium517Open in IMG/M
3300012903|Ga0157289_10326271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300012909|Ga0157290_10292486All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium597Open in IMG/M
3300012948|Ga0126375_10517116All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium894Open in IMG/M
3300014272|Ga0075327_1352089All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium500Open in IMG/M
3300014325|Ga0163163_12297990All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium598Open in IMG/M
3300014325|Ga0163163_12598622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium564Open in IMG/M
3300014878|Ga0180065_1146875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300015372|Ga0132256_102329900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium639Open in IMG/M
3300015373|Ga0132257_104184512All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium525Open in IMG/M
3300018031|Ga0184634_10339660All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium689Open in IMG/M
3300018481|Ga0190271_12371174All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium635Open in IMG/M
3300021081|Ga0210379_10405766All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium602Open in IMG/M
3300022896|Ga0247781_1099845All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium539Open in IMG/M
3300022899|Ga0247795_1087743All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium547Open in IMG/M
3300022915|Ga0247790_10170715All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium567Open in IMG/M
3300022915|Ga0247790_10222452All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300023064|Ga0247801_1084477All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium521Open in IMG/M
3300023070|Ga0247755_1142528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium516Open in IMG/M
3300023261|Ga0247796_1119848All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium518Open in IMG/M
3300024265|Ga0209976_10495193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium646Open in IMG/M
3300024275|Ga0247674_1032056All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium620Open in IMG/M
3300025002|Ga0209001_1047717All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium695Open in IMG/M
3300025862|Ga0209483_1337391All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium556Open in IMG/M
3300025923|Ga0207681_11671580All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium532Open in IMG/M
3300025926|Ga0207659_11635717All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium549Open in IMG/M
3300025938|Ga0207704_11511332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium576Open in IMG/M
3300025968|Ga0210103_1074101All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium558Open in IMG/M
3300026088|Ga0207641_12341060All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium533Open in IMG/M
3300027533|Ga0208185_1105267All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium661Open in IMG/M
3300027533|Ga0208185_1129266All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium587Open in IMG/M
3300027880|Ga0209481_10485073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium637Open in IMG/M
3300028380|Ga0268265_11888206All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium604Open in IMG/M
3300029293|Ga0135211_1028491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium665Open in IMG/M
3300031170|Ga0307498_10233817All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium658Open in IMG/M
3300031226|Ga0307497_10435341All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium634Open in IMG/M
3300031229|Ga0299913_11943320All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M
3300031720|Ga0307469_11619974All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium622Open in IMG/M
3300031768|Ga0318509_10767837All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium534Open in IMG/M
3300031834|Ga0315290_11115334All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium659Open in IMG/M
3300031857|Ga0315909_10909685All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium542Open in IMG/M
3300031940|Ga0310901_10600380All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300031944|Ga0310884_11032586All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M
3300031952|Ga0315294_11437874All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300031965|Ga0326597_11775895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium580Open in IMG/M
3300032118|Ga0315277_11741185All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium520Open in IMG/M
3300032143|Ga0315292_11109084All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium654Open in IMG/M
3300033290|Ga0318519_10769936All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium591Open in IMG/M
3300033487|Ga0316630_11610717All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium588Open in IMG/M
3300033487|Ga0316630_12223351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300034147|Ga0364925_0402614All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium519Open in IMG/M
3300034177|Ga0364932_0313068All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium593Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil13.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.88%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.96%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.96%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.96%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.96%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.98%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.98%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.98%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.98%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.98%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.98%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.98%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001133Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3EnvironmentalOpen in IMG/M
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009800Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012166Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2EnvironmentalOpen in IMG/M
3300012672Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300022896Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L184-509B-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023070Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300024265Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024275Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15EnvironmentalOpen in IMG/M
3300025002Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025968Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027533Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029293Marine harbor viral communities from the Indian Ocean - SCH2EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E1_093562002170459002Grass SoilDDHWSITRNPLSDYIHYDPLGLLLTSIQEITNEIISLTLQTIEHGIPQTFADPNVLDFNAYRNTEATPGAIYPTKPSAGKSIGDAFYEVKTATLSQEILPFFEKTQELGQLASGALPSLFGGAQPNSSKTATQYTMSRTQALQRLQTPWKMFTFWWKDIFSKVIPQFIECMEE
ICChiseqgaiiDRAFT_170591813300000033SoilVQEITNDIXXXALQTIEHGISQTFADPGVLNFEQYRQTEVLPGGVYPAVAKSGKALGEGFFETRTATLSQEVLPFFQQIQQLGQMASGALPSLFGGQIEGSKTASEYSMSRAQALQRLQNTWKMLTIWWKETFAKAINIYIQELKDDERQVEQDEKGNFINVFVRIAELEGKIGRIELEANE
ICChiseqgaiiFebDRAFT_1299951813300000363SoilNPLSDYIHHDPLGLLLVSIQEITNDLISLILQTIEHGIPQTFADPAVLNFPAYRKMEATPGGIYEATPKSGKTVGESFHEVKTATLSPEVMPFSSNIQSLAQLVSGALPSLFGGQVEGGSGTASEYSMSRAQALQRLQSTWKIFTAWWKQIFGKAIPMFISETKDDERDVQ
ICChiseqgaiiFebDRAFT_1325427513300000363SoilVNVQEITNDIXXXALQTIEHGISQTFADPGVLNFEQYRQTEVLPGGVYPAVAKSGKALGEGFFETRTATLSQEVLPFFQQIQQLGQMASGALPSLFGGQIEGSKTASEYSMSRAQALQRLQNTWKMLTIWWKETFAKAINIYIQELKDDERQVEQDEKGNFINVFVRIAELEGKIGRIELEANE
AP72_2010_repI_A10DRAFT_105832013300000651Forest SoilTNDLINLTLQTIEHGIPQTFADPEVLNFQQYRETEASPGSIFPAKAKSGKSISDGFYEVKTATLSQEVQPFAEKVEQLGQFTSGAQPSLFGGQQEQGSKTAAVYSMSRAQSLQRLQTPWQMFCIWWKNIHAKVIPAYIKEMQEDEHFTKMDALGNPITVMIKRAEVEGKIG
JGI11643J11755_1055323013300000787SoilTNDIISLALQTIEHGISQTFADPGVLNFEQYRQTEVLPXGVYPAVAKSGKALGEGFFETRTATLSQEVLPFFQQIQQLGQMASGALPSLFGGQIEGSKTASEYSMSRAQALQRLQNTWKMLTIWWKETFAKAINIYIQELKDDERQVEQDEKGNFINVFVRIAELEGKIGRIELEANE
AP72_2010_repI_A100DRAFT_106743713300000837Forest SoilKRFPDGAKVVYWNDQYCESENESLDDCWTLAYNPLSDYVHYDPHGLLLTSVQEITNDLINLTLQTIEHGIPQTFADPEVLNFQQYRETEASPGSIFPAKAKSGKSISDGFYEVKTATLSQEVQPFAEKVEQLGQFTSGAQPSLFGGQQEQGSKTAAVYSMSRAQSLQRL
JGI1027J12803_10098814213300000955SoilVLQTVEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGKPLSEGFYEVKTATLSQEVLPFAQKIQEIGQLVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQTTWKLLLYWWKNVFGKAIPLYINEMKDDEKQVKKDEFGNFINVFVRKAELEGKIGSIELEA
C687J13250_10308213300001133SoilGLQEITGDLVSLTKQTIEHGIPQTFADPSVLNFEGYRQLEATPGSIYPATPKSGKSMQDAFYEIKTATLSAEVLPFFQQIQTLAQLVSGALPSLFGGQMDGSKTASEYSMSRAQALQRLQTTWKTFTIWWKQIFGKVIPAYIKDIVEDERLVEQDEQGNFVNTFIRMAELQGKIGSIELEANENLPMTWTQQ
Ga0055491_1017335913300004050Natural And Restored WetlandsDPLGLLLTSIQEITNDLISLTLQTIEHGIPQTFADPTVLDFNAYRQMEVLPGGVYPATPRAGKSVQEGFYEVRTASLSGEILPFGQNVQQLGQLVSGALPSLFGGQMTESRTASEYSMSRAQALQRLQNTWKVFTVWWKQIFGKVIPAYIKDVKEDEKDVQRDTHGNFINVFVRKAELEGSLGKIELDASE
Ga0069718_1489292613300004481SedimentQTVEHGIGQTFADPAVLNFDAYRQMESVPGGIYEAIPKSGKTLADGFFEAKTASLSPEVMPFATQIQGLAQLVSGALPSLFGGSLQGSETASQYSMSRAQALQRLQNVWKMFTIWWKDIFGKVIPAYIQEVKEDERDVQRDNDGNFVNVFIRKAELEGKIGKVELEANENLPMTWSQQKD
Ga0062594_10265597813300005093SoilNPLSDYIHFDPIGLLLTSVQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRQSEVIPGGIYPATPKSGKPLSEGFYEVKTATLSQEVLPFAQKVQEIGQIVSGALPSLFGGQTAGSRTASEYSMSRAQALQRLQTTWKMLTMWWKQIFGKIIPMYIKEMKDDEKQVKRDEFGNFVNVFIR
Ga0065705_1106528713300005294Switchgrass RhizosphereHFDPLGLLLVSVQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGKPLSEGFYEVKTATLSAEVLPFATKVQEVGQLVSGALPSLFGGQVSGSRTASEYSMSRSQALQRLQTTWKMLTMWWKNVFGKVIPLYIKEMKDDERSVRKDEFGNFINVFIR
Ga0065705_1114224213300005294Switchgrass RhizosphereTYNPLADYLHFDPLGESLVSIQDITNDLISLVIQTIEHGIPQTFADPKVLNFNSYRNSEVIPGGIYPATPKSGKALSEGFYEVKTATLSQEVLPFAQKVQELGQVVSGALPSLFGGQMSGSRTASEYSMSRSQALQRLQSTWKMLLLWWKNVFGKAIPLYIKEMKDDEKQV
Ga0066665_1145967213300006796SoilEITNDLISLILQTIEHGIGQTFADPGVLNFPAYRNMEAVPGGIYEAIPKSGKGLNDAFYEARTATLSPEVMPFATNIQSLAQLVSGALPSLFGGALQGSETASQYSMSRAQALQRLQNVWKIFTIWWKQIFGKAIPLFIKLVQDDERDVQRNQDGSFINVFIRKAELEGKIGQIEL
Ga0075425_10219494213300006854Populus RhizospherePLSDYLHFDPIGLLLTSVQDITNDLISLVLQTIEHGIPQTFADPKVLNFNSYRNSEVIPGGIYPASPKAGRALSEGFYEVRTATLSQEVLPFAEKVQEIGQLVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKLLLLWWKNVFGKAIPLYIKEMRDDERQVKKDEFGNFINVFVRRAELEGKIGSIELEANENLPIT
Ga0068865_10116773513300006881Miscanthus RhizosphereSIQDITNDMISLVIQTIEHGIPQTFADPKVLNFNAYREAEVIPGGIYPATPKSGKALSEGFYEVKTATLSQEVLPFAEKIQELGQVVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGNWKMLTMWWKNIFGKVIPMYIKEMKDDEKQVKKDEFGNFINVFIRRAELEGKIGSIELEANENLPITWNQQKDAIMELFQINNEGINQSLASPENLPYLKKAIGL
Ga0068865_10176086613300006881Miscanthus RhizosphereIGLLLVSVQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGKPLSEGFYEVRTATLSQEVLPFAQKIQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQSTWKMLTMWWKDIFGKIIPMYIATVKDDEKQVKKDEFGNFINVFIRKAELEGKIGSVELE
Ga0079303_1030436013300006930Deep SubsurfaceAENSALDDCWTLTYNPLSDYLHHDPLGLLLTSIQEITNDLISLTLQTIEHGIPQTFADPTVLDFNAYRQMEVLPGGVYPATPRAGQSVQNGFYEVRTATLSSEVLPFGQNVQQLGQLVSGALPSLFGGQMTESKTASEYAMSRSQALQRLQNVWKIFTIWWKQVFSKVIPAYIKDVQEDEKDVKMDTYGNFVNVFIRKAELEGKIGKIELEANENLPMT
Ga0075419_1107182013300006969Populus RhizosphereNESLDDCWTLTYNPLSDYIHFDPLGILLTSVQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGRALSEGFYEVKTATLSQEVLPFAEKIQQIGQLVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQSTWKMLLLWWKNVFGKAIPLYIKVMKDDEKQVKKDEFGNFVNVFIRV
Ga0075419_1117016213300006969Populus RhizosphereNPLSDYIHFDPIGLLLTSVQDITNDLISLVVQTVEHGIPQTFADPKVLNFKAYRNAEVAPGSIHPATPKSGKSLSDAFYEVKTATLSQEVLPFAQKIQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQSTWKMLLTWWKNVNGKAIPLFIKEMKDDEKQVKKDEFGNFINVFIRRAELE
Ga0075419_1129025313300006969Populus RhizosphereSDYLYYDPLGSLLTSIQEITTDLVSLVLQTIEHGIPQTFADPSVLNFNQYNQTEATPGMIFPAKAPIGKSINDGFYEVKTALLSGEVEPFMQRIQEAGQFVSGALPSLFGGAAPNSSKTAAQYAMSRAQALQRLQTPWKVLTFWWKDIFGKAIQAYIENVIEDERFTKPDAQGGYVNVFI
Ga0105093_1051141813300009037Freshwater SedimentDYLHHDPLGLLLVSIQEITNDLISLTLQTVEHGIGQTFADPAVLNFNAYRQMESVPGGIYEAVPKSGKALSDGFFEIKTANLSPEVMPFATNIQSLAQLVSGALPSLFGGAMAGSETASQYSMSRAQALQRLQNTWKIFTIWWKEIFGKVIPAYIQEVKEDERDVDRDSDGNFVNTFIRRAELEGKIGKVELEANENLPLTWSQQKDVIMQLLAAANPEILA
Ga0105107_1081644013300009087Freshwater SedimentTLTKNPLSDYLHHDPLGVVLVSVQDITNDIISLVLQTIEHGIPQTFANPSVLNFDAYRQMEVAPGTIFPTKPGFSKPIGEAFYEIKTATLSGEILPFLTRLQEMGQLVSGALPSLFGGMQAAGSRTASEYSMSRAQALQRLQTPWKMLTIWWKEVFGKVIPAYMKSVVDDQKFVEKDSSGNYINVFLKKADLQGKIGEIELEASEQLPITWAQKSE
Ga0111539_1295923213300009094Populus RhizosphereWTLTYNPLADYIHFDPLGLLLTSIQDITNDLISLTLQTIEHGVGLTFADPAVLNFRAYQQQEVQPGSMFPATPKSGKSLNEAFHELKTATLSGEVMPFANNIQQMGQLVSGALPSLFGGQLEGSETASEYSMSKSQALQRLQNTWKMLCIWWKNIYGKAVPMYIKLVEQDQRDVQRTKDGSF
Ga0113563_1252278513300009167Freshwater WetlandsITNDLVSLTIQTIEHGIPQTFADPTVLDFNAYRQMEVLPGGVYPATPRAGKSVGEGFYEVRTATLSSEILPFGQNVQQLGQLVSGALPSLFGGQMTESRTASEYSMSRNQALQRLQNVWKIFNVWWKTIFGKVIPAYIKDVKEDERDVIKDTYGNFVNVFVRKAELEGKLGRIELEASENLPMTWNQRKDIVMQLLQLGNPDILEI
Ga0105249_1170781113300009553Switchgrass RhizosphereKEYPDGVKAVLVNDLVASACNENLDDCWTITYNPLADYVHFDPIGLLLTSVQDITNDLISLVIQTVEHGIPQTFADPKVLNFNSYRNSEVIPGGIYPATPKSGRSLSEGFYEVKTATLSQEVLPFAQKIQEIGQLVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQTTWKMLLYWWKNVFGKAIPLYIKEMKDDEKQVKRDEFGNFINVFVRKSELEGRIGSIELEANEN
Ga0105340_132578613300009610SoilNEGLDAHWTLTYNPLSDYLHFDPVGLLLTSVQDITNDLISLTLQTIEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGRPLSEGFYEVKTATLSQEVLPFGQEVQQIGQLVSGALPSLFGGQMAGSRTASEYSMSRAQALQRLQGTWKLLLLWWKNVFGKAIPLYIKDMQDDEKQVKKDEFGNFVNVFIRRAELEGKIGSVELEANENLPITWNQQKDA
Ga0105069_101023913300009800Groundwater SandMEVLKKQFPDGVCVELASDQVAAGNNAKLDDAWTLTYNPLSDHIHFDPVGLLLTSIQDITNDLISLVIQTIEHGIPQTFADPKVLNFHAYRNSEVIPGGIYPATPKSGRPLQEGFYEVKTATLSQEVLPFAQKVQEMGQLVSGALPSLFGGQMAGSRTASEYSMSRAQALQR
Ga0126305_1074611713300010036Serpentine SoilPVNNVTIRNAWIRPSAFNILNEDEMQSLKKQFPNGVKAVIVNDFVADGVNENLDDCWTITHNPLSDYLHFDPVGLLLTSVQDITNDLISLVLQTIEHGIPQTFADPKVLNFKAYRESEVIPGGIYPATPKSGRPLGEGFYEVKTATLSQEVLPFAEKVQQLGQMVSGALPSLFGGQMAGSRTASEYSMSRAQALQRLQSTWKMLLLWWKNVFGKAIPLYI
Ga0126382_1093001323300010047Tropical Forest SoilMVSIQEIMNDLVSLTMQTIEHGIGQTFADPAVLNFNAYRQMESVPGGIYEAKAATGKSISDGFHEVKTATLSPEVMPFTTNIQSLGQIVTGALPSLFGGAIQGAETASQYSMSRAQALQRLQNTWKMFTTWWKQIFGKVIPMYIEVTKDQGDDKEVQLTREGGFVNVFIRRAELEGKIGKVELEANENMPITWAQQKDI
Ga0126376_1251487113300010359Tropical Forest SoilWTLTYNPLSDYIHFDPSGSQLVSIQDITNDLVSLVLQTIEHGIGQTFADPKVLNFKKYSQTEVAPGSIYPVTAAPGKALSDSFFELKTANLSPEVMGFFQRIQELGQLVSGALPSLFGGQVEGSRTASEYSMSRAQALQRQQNTWKIFTTWWKDIFSKVIPMFIQEMQDDERYVEKSEVGFFNVFIR
Ga0126379_1242580713300010366Tropical Forest SoilPDGCHVTMVNDAFAEACNECLDDHWTLTRNPLANYLQSDPIGMLLTSLQEITNDLVSLILQTIEHGVPLTFADPTVLNFNAFSQVEVTPGGMFPASAKSGKSLGESFFETRTSTLSQEVMPFQQSVQSMAQLVSGALPSLFGGQIEGSETASQYSMSRSQALQRLQNTWKIFIVWWKEIFGKAIPMAIDEVKDDEKDVQRDKNGNFI
Ga0134122_1255785313300010400Terrestrial SoilYDPLGVLLNPIQDITNDIVSLTLQTIEHGIPQTFVDPKVVNFDSYRKSEVIPGGIYPATPRMGKPVSDGFYEIKTATLSDEVLPFAQKIQELGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQNTWKMLTLWWKDVFAKVIPLYIKEMKDDERQVQKDEFGNFINVFIRKSELEGKIGSI
Ga0134123_1352620113300010403Terrestrial SoilNDEVAHACNEDLDDYWTLTYNPLSDYVHFDPIGLLLTSVQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGRALSEGFYEVKTATLSNEVLPFAQKIQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQSTWKMLLLWWK
Ga0137356_109928213300011402SoilECDDLKKQFPDGVKIVVVNDLIADATNEALDDFWTLTYNPLSDHIHFDPVGLLLTSVQDITNDLISLVLQTIEHGIPQTFADPKVLNFHAYRNSEVIPGGIYPATPKTGKALGEGFYEVKTATLSAEVLPFAQKVQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKMLLL
Ga0137325_107838913300011415SoilADDCNEALDDSWTIMYDPMADFLHKKPMGSLLVNVQEITNDIISLALQTIEHGISQTFADPGVLNFEQYRQTEVLPGGVYPAVAKSGKALGEGFFETKTASLSQEVLPFFQQIQQLGQMASGALPSLFGGQIEGSKTASEYSMSRAQALQRLQNTWKMLTIWWKESFGKAINIYIQELKEDERQVEQDEKGNFINVFVRIAELEGKIGRIELEANENLPVTWSQRKDTYMKLLEQQNPVILEA
Ga0137423_125084813300011430SoilVVVNDLVADAENEALDDCWTITYNPLSDYLHFDPPGLLLVSIQDITNDLISLVLQTIEHGIPQTFADPKVLNFNAYRNAEVIPGGIYPATPKSGKSLGDGFYEVRTATLSAEVLPFAEKTQQLGQMVSGALPSLFGGQMSGSRTASEYSMSRSQALQRLQTTWKMLTYWWKNIY
Ga0137438_115629513300011431SoilLNDYLQHAPLGLLLTSIQEITNDLVSLTLQTVEHGIPQTFADKGVLDFQAYRNTEVAPGMIFPVTPKSGKSIGDSFYEVKTASLSGEVMPFGEKIQSLGQLVSGALPSLFGGQMSESKTASEYSMSRAQALQRLQNTWKIFTFWWKNIFGKVIPAYLKCIQEDEREVEMNEFGNFVNTYIRYAELQGKIGRVELEANENLPMTWQQKKDVVIMLLQTGNPEILSILGAPENL
Ga0137426_124270413300011435SoilDITNDLISLTLQTIEHGIPQTFADPKVLNFNAYRNAEVIPGGIYPATPKTGKPLSEGFYEVKTATLSQEVLPFAQKIQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKMLLLWWKNVFAKAIPLYIKEMKEDDKQVKKDEFGNFVNVFIRRSELEGKIGSIELEAN
Ga0137451_116233613300011438SoilVNGEFALANNEAFDDFWTLTYNPLADYLYYNPLGMTLVSVQDITNDLISLVLQTIEHGIGQTFADPAVLNFNAYTQTEVLPGGMFPATPKSGKSLAEGFHELRTATLSAEVLPFFQQIQTLGQIVSGALPSLFGGQQTGVGGDTASGYSMSRAQALQRLQNTWKVFTTAWKEMFGKVIPCYIKETVEDEKFVERSDDGNFVNTFIRKAELEGKIGRIELEANENLPMTWAQTK
Ga0137427_1048607013300011445SoilNDLISLVLQTIEHGIGQTFADPGVLNFNAYEQTSTLPGGVFPATPKTGKSLTDAFHELKTATLSAEVMPFSQLIQSMGQTTSGALPSIFGGELAGAGGDTASGYSQSRAQALQRLQNTWKLFTTTWKEMFGKIIPMYIKLVKESGDERDVQRQDDGNFVNVLIRKAEL
Ga0137431_115524813300012038SoilHNPLSDYLHFDPIGLLLTSVQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGKPLSEGFYEVKTATLSQEVLPFAQKIQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRSQALQRLQTTWKMLTMWWKDVFGKVIPMYISEVKDDEKQVKKDEFGNFVNVFIRRAELEGKIGNIELEANENLPITWNQQKDAIMEL
Ga0137350_110062113300012166SoilITQNPLSDYLIHDPLGESLVSVQDITNTLISLVLQTIEHGIPQTFVSPAVLNIDQYGQTEATPGAITATKANFNKPLSEGFFEIKTATLSQEVMPFAQQIQEMGQLVTGALPSLFGGQIDGSKTASEYSMSRAQALQRLQNTWKMFNIWWKTIFGKAIPMFIDEMQTDERDVKRNADGSFFNVFIRRAELEGKI
Ga0137317_103448513300012672SoilDYWTLTYNPLSDYIHFDPVGLLLTSVQDITNDLISLVLQTIEHGIPQTFADPKVLNFKAYRESEVIPGGIYPATPKTGRPLGEGFYEVKTATLSQEVLPFAQKVQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKMLLLWWKNVFGKAIPLYIKEMK
Ga0157309_1028766413300012895SoilKMFPNGVKCVMVNDLVADACNEALDDYWTLTYNPLSDYLHFDPVGLLLTSVQDITNDLISLVLQTIEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGRPLGEGFYEVKTATLSQEVLPFAQKVQEMGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKMLLLWWKGI
Ga0157292_1040579413300012900SoilYIHFDPAGSQLVSIQDITNDIISLVLQTIEHGIGQTFADPKVLNFKKYGETEVAPGSIYPVNAAPGKSLQESFYELKTANLSPEVLPFFQKVQELGQLTSGALPSLFGGNLTSGGGTASEYSMSRAQAMQRQQNTWKIFTSWWKDIYSKVIPMYIKEMQEDERDVQQNEAG
Ga0157289_1032627113300012903SoilWTLTYNPLSDYIHFDPIGLLLTSVQEITNDLISLTVQTIEHGIPQTFADPKVLNFKAYRESEAIPGGIYPATPKSGKPLGEGFYEVKTATLSQETLPFAEKIQQMGQIVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQTTWKMLTMWWKDTFGKAIPMYIDEVREDEKSVKKDEFGNFVN
Ga0157290_1029248613300012909SoilLTYNPLSDFIHFDPVGLLLTSVQDITNDLISLVLQTIEHGIPQTFADPTVLNFNAYRNAEVLPGGISRATPKSGKALSEGFYDIKTATLSQEVLPFAQKVQEMGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKMLLLWWKQVFGKVIPMYIKEMKDDEKQVKKDEFGNFINVFVRMAELQGKIGSVEL
Ga0126375_1051711613300012948Tropical Forest SoilLNKDEADELKKQFPDGVKVEVVDDCIACACNEALDDYWTLTYNPLSDYIHFDPLGLLLVSVQDITNDLISLVLQTIEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGKPLSEGFYEVKTATLSQEVLPFAKEVQNIGQLVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQTTWKMLLLWWKNIFGKVIPMYIKEMKDDEKQVKKDEFGNFVNVF
Ga0075327_135208913300014272Natural And Restored WetlandsDPLGLLLVSIQEITNDLISLVLQTIEHGIPQTFADPAVLNFKAYRETESIPGGIYEATPKSGKSVGDAFYEVRTATLSQEVLPFANNIQSLAQLVSGALPSLFGGQIQGSETASEYSMSRAQALQRLQTVWKIFTMWWKEIFGKVIPIYIKEVKEDERDVQQNKDG
Ga0163163_1229799013300014325Switchgrass RhizosphereDYVHFDPIGLLLTSVQDITNDLISLVVQTVEHGIPQTFADPKVLNFNSYRNSEVIPGGIYPATPKSGRALSEGFYEVKTATLSQEVLPFAQKIQEIGQLVSGALPSLFGGQMSGSRTASEYSMSRSQALQRLQTTWKMLLYWWKNVFGKAIPLYMKEMKDDEKQVKKDEFGNFINVFVRKAELEGKIGSVELEANENLP
Ga0163163_1259862213300014325Switchgrass RhizosphereLTSVQDITNDLISLTLQTIEHGIPQTFADPKVLNFNAYRNSEVAPGSIYPATPKSGKPLAEGFYEVKTATLSQEVLPFAEKIQQMGQIVSGALPSLFGGQMSGSRTASVYSMSRAQALQRLQTTWKMLTLWWKDVFGKVIPMYMKEVQEDEKQVKKDEFGNFINVFIRKSEMEGKIGNVELEANENLP
Ga0180065_114687513300014878SoilTITQNPLSDYLIHDPLGESLVSVQDITNTLISLVLQTIEHGIPQTFVSPAVLNIDQYGQTEATPGAITATKANFNKPLSEGFFEIKTATLSQEVMPFAQQIQEMGQLVTGALPSLFGGQIDGSKTASEYSMSRAQALQRLQNTWKMFTIWWKEIFGKVIPAYMECLKEDEKFVTKGEQGD
Ga0132256_10232990013300015372Arabidopsis RhizosphereHHDPLGLLLTSIQDITNDLTSLIIQTIEHGIPQTFADPAVINFEKYRQSEVIPGGIYPATPRSGKSVGDAFHEVKTATLSQEVLPFFEKIQELGQIISGALPSLFGGQVSGSRTASEYSMSRAQALQRLQNNWKIFTIWWKIIFSKIIPMYMKEIKEDEHNVEMDDQGRFVNVFIRKAEMEGKIGRVELEANENLPLTWSQQKDVYMQLLDN
Ga0132257_10418451213300015373Arabidopsis RhizosphereDYIHHDPLGLLLTSIQDITNDLTSLIIQTIEHGIPQTFADPAVINFEKYRQSEVIPGGIYPATPRSGKSVGDAFHEVKTATLSQEVLPFFEKIQELGQIISGALPSLFGGQVSGSRTASEYSMSRAQALQRLQNNWKIFTIWWKIIFSKIIPMYMKEIKEDEHNVEMDDQGRFVN
Ga0184634_1033966013300018031Groundwater SedimentGEHPVNNVTCRTAWIRPCAFNILTKEEMEDLKKKFPDGVKIEMANDLVADASNANMDDSWTLTYNPLSDYIHFDPIGLLLTSVQDITNDLISLVLQTVEHGIPQTFADPKVLNFHAYRNSEVIPGGIYPATPKAGKPLHEGFYEVKTATLSQEVLPFAQKVQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKMLLLWWKNVFGKAIPLYIKVMKDD
Ga0184627_1065347413300018079Groundwater SedimentNECLDDYWTLLENPLSDFLHFDPAGQGVTSIQEITGDMISLILQTIEHGIGQTFVDPTVLDFKAYEQTEVTPGGVFPAKPKSGRTLNDGFHEMKTATLSAEVLPFFSQVQSLAQLASGALPSIFGGQIEGSETASEYSMSRAQAQQRLQNTWKMFTTLWKTTFGKVIPMYIKE
Ga0190271_1237117413300018481SoilSAFNILTKEEMENLKEQFPDGVKIVIINDLVADGTNDKLDDSWTLTYNPLSDYIHFDPIGLLLTSVQDITNDLISLVLQTIEHGIPQTFADPKVLNFNAYRNAEVIPGGIYPATPKSGKTLAEGFYDVKTATLSQEVLPFAQKVQEMGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKMLLLWWKNIFGKVIPMYIKEMKD
Ga0210379_1040576613300021081Groundwater SedimentVHYDPLGLLLVSIQEITNDLLSLTLQTIEHGIGQTFADPAVLSFKAYNQTEVTPGGIFPAQAKSGKTLGEGFHELKTATLSAEVLPFAQQIQNLGQLVSGALPSLFGGQLEGSETASEYSMSRAQALQRLQNTWKMFNIWWKTIFGKAIPMFIDEMQTDERDVKRNADGSFFNVFIRRAELEGKIGKVEIEANENLPLTW
Ga0247781_109984513300022896Plant LitterDYIHFDPIGLLLTSVQEITNDLISLTVQTIEHGIPQTFADPKVLNFKAYRESEAIPGGIYPATPKSGKPLGEGFYEVKTATLSQETLPFAEKIQQMGQIVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQTTWKMLTMWWKDTFGKAIPMYIDEVREDEKSVKKDEFGNFVNVFVR
Ga0247795_108774313300022899SoilDDNWTILENPMADYLHYEPAGQGLVSIQEITNDLTSLVLQTIEHGIGQTFADPAVLDFTAYGQTEVTPGGIFPAKPKSGKSLNDGFMELKTATLSQEVMPFSTQVQSMAQLTSGALPSLFGGNMEGTETASQYSMSRAQALQRQQNTWKMFTIWWKRIFGKVIPLFIKEMKDDERDVQRDKQ
Ga0247790_1017071513300022915SoilNPMADYLHYEPAGQGLVSIQEITNDLTSLVLQTIEHGIGQTFADPAVLDFTAYGQTEVTPGGIFPAKPKSGKSLNDGFMELKTATLSQEVMPFSTQVQSMAQLTSGALPSLFGGNMEGTETASQYSMSRAQALQRQQNTWKMFTIWWKRIFGKVIPLFIKEMKDDERDVQRDKQGNFINTMIRKSEVEG
Ga0247790_1022245213300022915SoilTSVQDITNDLISLVLQTIEHGIPQTFADPKVLNFNAYRNAEVIPGGIYPATPKSGKALSEGFYDIKTATLSQEVLPFAQKVQEMGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKMLLLWWKQVFGKVIPMYIKEMKDDEKQVKKDEFGNFINVLVRMA
Ga0247801_108447713300023064SoilLSDYIHFDPLGLLLTSVQDITNDLISLTLQTIEHGIPQTFADPKVLNFNAYRNSEVAPGSIYPATPKSGKPLAEGFYEVKTATLSQEVLPFAEKIQQMGQIVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQTTWKMLTLWWKDVFGKVIPMYMKEVQEDEKQVKKDEFG
Ga0247755_114252813300023070Plant LitterTIEHGIPQTFADPKVLNFNAYRNAEVIPGGIYPATPKSGKPLHEGFYEVKTATLSQEVLPFAQKVQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKMLLLWWKNVFGKAIPLYIKEMKDDEKQVQKDEFGNFVNVFIRRSELQGKIGSVELEANENLP
Ga0247796_111984813300023261SoilVVMVNDNVAAGCNAKLDDSWTLTYNPLSDFIHFDPVGLLLTSVQDITNDLISLVLQTIEHGIPQTFADPKVLNFNAYRNAEVIPGGIYPATPKSGKALSEGFYDIKTATLSQEVLPFAQKVQEMGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKMLLLWWK
Ga0209976_1049519313300024265Deep SubsurfaceLLTSIQDITNELISLVLQTIEHGIPQTFADTAVLNFKQYSETEVSPGTIFPARAQSGKNIGEGFYEIKTATLSGEVLPFGDKIQQLGQLVSGALPSLFGGAMPGSGQTASEYSMSRAQALQRLQNTWKMFTAWWKEIFGKVIPAYIEDVEEDETFVKEDPSAPGNYITVFIRKSELEGKIGNIELEASENLPVSSNQVKDTVMELMAINNPAIIE
Ga0247674_103205613300024275SoilYPDGVKVVVVNDQVAHACNEALDDYWTLTYNPLSDYIHFDPLGLLLTSVQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGRALSEGFYEVRTATLSQEVLPFAQKIQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRSQALQRLQTTWKMLLSWWKNVFGKVIPLYIAEMKDDEKQVKKNEFGN
Ga0209001_104771713300025002SoilVGDTFAEAEGESLDDCWTLTLNPLSDFIHSDPPGLLLVSLQEITNDLISLILQTIEHGIPQTFADPSVLNFEGYRQLEATPGSIYPATPKSGKSMQDAFYEIKTATLSAEVMPVLEQTQSFAQLVSGALPSLFGGQLDGSKTASEYSMSKAQALQRLQTTWKVFTIWWKQIFGKVIPAYIKDIVEDERLVEQDEQGNFVNTFIRMAELQGKIGNIELEANENLPMTWTQQR
Ga0209483_133739113300025862Arctic Peat SoilAVPEALDDHWTINYNPLSDYLHFNPLGLLLASIQEITGDLISLTLQTIEHGVGLTFADPGVLDFKAYAQTEVTPGAVLPTKALSGKNIKDGFFETRTASLSSEVLPFFQNIQSLGQLVSGALPSLFGGQIQGSETASQYSMSRSQALQRLQNTWKMLTIWWKNVYGKAIPMYIKEVKEDEHEVQF
Ga0207662_1094108413300025918Switchgrass RhizosphereKYPHGVCVTYVNDIFAKAYDESLDDHWTLLENPLSDYIHFQPSGEGLVSVQEITNDLISLTLQTIEHGIGQTFVDPSVLDFTAYSQQEVLPGGVFPTKVQGTKKIGDGFFELRTATLSSEVLPFSNQIQSLGQLQSGALPTLFGGALEGSETASQYSMSGAQARQRQQNTWKMLTLWWKNIFGKVIPAYIKTVQEDEHDVQIGE
Ga0207681_1167158013300025923Switchgrass RhizosphereKVVVVNDQVAHACNENLDDFWTITHNPLSDYLHFDPIGLLLTSVQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGKPLSEGFYEVKTATLSQEVLPFAQKIQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRSQALQRLQTTWKMLTMWWKDVF
Ga0207659_1163571713300025926Miscanthus RhizosphereVQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRQSEVIPGGIYPATPKSGKPLSEGFYEVKTATLSQEVLPFAQKVQEIGQIVSGALPSLFGGQTAGSRTASEYSMSRAQALQRLQTTWKMLTMWWKQIFGKIIPMYIKEMKDDEKQVKRDEFGNFVNVFIRMAELQGKIGNIELEANE
Ga0207704_1151133213300025938Miscanthus RhizosphereIGLLLVSVQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGKPLSEGFYEVRTATLSQEVLPFAQKIQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQSTWKMLTMWWKDIFGKIIPMYIATVKDDEKQVKKDEFGNFINVFIRKAELEGKIGSVELEANENLP
Ga0210103_107410113300025968Natural And Restored WetlandsDPLGLLLTSIQEITNDLISLTLQTIEHGIPQTFADPTVLDFNAYRQMEVLPGGVYPATPRAGKSVQEGFYEVRTASLSGEILPFGQNVQQLGQLVSGALPSLFGGQMTESRTASEYSMSRAQALQRLQNTWKVFTVWWKQIFGKVIPAYIKDVKEDEKDVQRDTHGNFINVFVRKAELEGSLGKI
Ga0207641_1234106013300026088Switchgrass RhizosphereAYNECLDDHWTLSRNPLSDHLHFQPLGMLLTSVQDITNELISLVLQTIEHGIPQTFADPGVLNFDAYRQVETAPGSIFPATPKSGKSLGEAFYEVKTAALSAEVLPFGESVQQMGQTASGALPSLFGGAQPNSSKTASQYLTSKNQAMQRLQTPWKMICIWWKEMFGKAIPAYIQEM
Ga0208185_110526713300027533SoilNEGLDAHWTLTYNPLSDYLHFDPVGLLLTSVQDITNDLISLTLQTIEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGRPLSEGFYEVKTATLSQEVLPFGQEVQQIGQLVSGALPSLFGGQMAGSRTASEYSMSRAQALQRLQGTWKLLLLWWKNVFGKAIPLYIKDMQDDEKQVKKDEFGNFVNVFIRRAELEGKIGSVELEANENLPITWN
Ga0208185_112926613300027533SoilQDITNDLISLVLQTVEHGIPQTFADPKVLNFNAYRNSEVIPGGIYPATPKSGKPLSEGFYEVKTATLSQEVLPFAQKIQEIGQLVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQTSWKMLLAWWKNVHSKTIPLFIKEMRDDEKQVKKDEFGNFINVFIRKAELEGKIGSIELEANENLPITWNQQKDAIM
Ga0209166_1062011713300027857Surface SoilFAEAENESLDDCWTLTYNPLSEYIHFDPVGLLLTSIQEITNDLISLTIQTVEHGITQTFADPSVLNFEQYRQTEATPGAIFPARPKSGKGLNDSFYELKTATLSQEIGPFGEKIQELGQFVSGALPSLFGGNQPSSSRTAAQYAMSRAQSLQRLQTPWKMLLFWWKNVFAKAVPGYIKTMLE
Ga0209481_1048507313300027880Populus RhizosphereVVVNDFVADACNEALDDSWTLTYNPLSDYIHFDPIGLLLTSVQDITNDLISLVVQTVEHGIPQTFADPKVLNFKAYRNAEVAPGSIHPATPKSGKSLSDAFYEVKTATLSQEVLPFAQKIQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQSTWKMLLTWWKNVNGKAIPLFIKEMKDDEKQVKKDEFGNFINVFIRRAELE
Ga0268265_1188820613300028380Switchgrass RhizosphereVYFDPLGMLLTSVQEITNDIISLTLQTMEHGVGQTFADPAVLNFKAYEQTEVTPGGVFPATAKSGKTLSEGFHEMKTATLSAEVMPFANQIQSLGQLCSAAQPSIFGGQLQGSETASEYSMSRSQALQRLQNVWKMLTMGWKNVFGKAIPMYIKIVHEDERDVQRTKDGNFINTFIRKAELEGKIGKIELEANENLPMTWG
Ga0135211_102849113300029293Marine HarborFPVTITFAEAVPEVLDDCWTLTRNPLSDYVHSDPLGLLLMSIQDITNDLISLVLQTIEHGVGLTFYDPAVLNQKQFEQTEVTPGGMFPATPKSGKSMNDAFHEIKTATLSGEILPFGQNVQSLGQLVVGAMPSIFGGELEGSGTASEYSMSRAQSLQRLQNTWKMLTAWWKTIFGKVIPMYIAEVKDDERDVQRDTNGNFINVFIRKAELEGKIGKVELEA
Ga0307498_1023381713300031170SoilTIIYNPMSDYLQQQPPAALLANIQDITSDIISLVLQTMEHGISQTFADPGVLNFDKYKQSEATPGSVYPAAAKSGKSVGDAFFETRTATLSSEVLPFFQQIQILGQTVSGAQPSLFGGQLSGSRTASEYSMSRAQALQRLQNTWKMFTIWWKQIFGKVIPMYISEIKEDEKTVEQDERGNFINVFVRKAELEGKIGRIELEANENLPITWSQRKDTYMQ
Ga0307497_1043534113300031226SoilILHEDEVETLKKLYPNGVKVVVVNDLVAYACNEALDDSWTLTYNPLSDNIHFDPIGLLLTSVQDITNDLISLVLQTIEHGIPQTFADPKVLNFKSYRESEVIPGGIYPATPKSGKPLSEGFYEVRTATLSQEVLPFAQKVQEIGQLVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQTTWKMLLMWWKQVFGKVIPMYIKEMKDDEK
Ga0299913_1194332013300031229SoilKFPKGAKVCIINEELAEYAEESLDEHWTLTHNPLADYLQHDPVGLLLTSIQEITNDLISLILQTIEHGIPQTFADPQVLNFQAYRNSEAGPGMIFPITAKSGRQLSESFYEVKTASLSPEVFPFATFAQQLGQQVSGALPSLFGGQMEGSKTASEYSMSRSQALQRLQNTWKMLTIW
Ga0307469_1161997413300031720Hardwood Forest SoilTNDIISLTLQTIQHGITQTFADPAVLDFKTYGDTETTPGGVYQATPRSGKTLADGFYEMKTATLSGETLPFFQQVQSLGQLVSGALPSLFGGQLEGSDTASEYSMSRAQALQRLQNTWKILTIFRKNLGGKVINNYIKEVTHDEKDVVKTNDGNFMNVFIRRSEMEGKIGKIELEANENLPLTWAQIKDVVMNLLNTQNPMLQSFL
Ga0318509_1076783713300031768SoilHGISQTFADPSVLNFNAYRQIETVPGGIYEANPKTGKSLNEAFYEAKTATLSQEVMPFLNELQSLAQLVSGALPSLFGGAIEGSETASQYSMSRAQALQRLQNNWKTFTIWWKQIFGKVIPMYIKVTKDEGDEKEVQLDKDGNFINVFIRKAELEGKIGRVELEANENLPMTWAQQK
Ga0315290_1111533413300031834SedimentKLKELYPNGAKVTLVNDEFGDATNERLDDSWTLTYNPLSDYLHHDPLGLLLVSIQEITNDIISLTLQTIEHGIGQTFADPAVLNFNAYRQMESVPGGIYEAVPKSGKSIGDAFHEVKTANLSPEVMPFAQNIQNLAQLVSGALPSLFGGQLEGSETASQYSMSRSQALQRLQNVWKIFTVFWKQIFGKAIPAYIQEVKEDERNVERDKDGNFINVFIRK
Ga0315909_1090968513300031857FreshwaterLLTSVQEITNDITSLTLQTIEHGIPQTFADPAVLNFDQYGKQETSPGAIYPATPKSGKSMQDAFYEVRTATLSSEVMPFASQIQSLGQTVSGALPSLFGGDIQGSKTASQYSMSRAQALQRLQNTWKMFTSWWKQIFGKVIPAYINDVRDDEKYVERDKSGNFINIVIHRAELEGKLGQI
Ga0310901_1060038013300031940SoilAEACEEDLDTCWTIAKNPLADYLHSQPLGVALVSVQDITNELISLILQTIEHGIPQTFADPKVLDFNAYRQSEVAPGQIFPATQQAGKAVGEAFYEVKTATLSQEVLPFSEQLQQLGQLASGALPSLFGGAAPGTSKTASEYNTSKNQAMQRLQTTWTMLRIWWKEL
Ga0310884_1103258613300031944SoilENENVDDCWTVTKNPLSDYVHFDPIGLLLTSVQEITNEIISLVLQTVEHGIPQTFADPSVVDFNAYRQSESTPGAIYPVKNTNGKPLGEAFYEVKTSALSAEVLPFAEKINELGQLASGALPSLFGGPQANSSKTAAQYSMSRTQALQRLQTPWKMFTFWWKEIFGKVIP
Ga0315294_1143787413300031952SedimentIEHGIGQTFADPAVLNFNAYRQMESVPGGIYEAVPKSGKTLSDGFHEIKTANLSPEVMPFATNIQGLAQLVSGALPSLFGGQMQGAETASQYSMSRAQALQRLQNTWKIFTIWWKEIFGKVIPAYIQEVKEDERDVQRDPDGNFINVFIRKAELEGKIGKVELEANENLPLTWSQQKDTI
Ga0326597_1177589513300031965SoilDFESYRQMETTPGAIYPATPKSGKSVSDAFYEVKTAALSHEVLPFAQNIQEMGQLVSGALPSLFGGEMGGSKTAAQYSMSRAQALQRLQTPWKMLQVWWKQIFGKVIPSYMKDIVEEEKFVEKDVDGNFVNVVVRKSQLTGKLGNIELEASEELPITWSQQRDVIMQLMQAGNPQVFEALTTPENLQLVARAI
Ga0315284_1198208313300032053SedimentIREWWLRASAFNVLPEEDAKELKRRFPDGCKVVFVNNEFAEACNASLDDEWTLTQNPLSQYLHFQPLGTLITSVQEITNDLISLTLQTIEHGIPQTFADPQVLNFNQYAQTEATPGGIFPAKPKAGQRIGDAFYEVKTATLSGEVLPFGNKVQELGQFVSGALPSLWGGSQDSSSRTAAQYSMSRSQSMQRLQTPWK
Ga0315277_1174118513300032118SedimentNDEFGDAENERLDDSWTLTYNPLSDYLHHDPLGLLLVSIQEITNDIISLTLQTIEHGIGQTFADPGVLNFNAYRQMESVPGGIYEAVPKSGKSIGDAFHEVKTANLSPEVMPFAQNIQSLAQLVSGALPSLFGGQVEQGSGTASEYSMSRAQALQRLQNVWKIFTLWWKDIF
Ga0315292_1110908413300032143SedimentVNDEFGDAYNERLDDSWTLTYNPLSDYLYHDPLGLLLVSVQEITNDLISLTLQTVEHGIGQTFADPGVLNFDAYRQMESVPGGIYEAIPKSGKTLSEGFHEIKTANLSPEVQPFATQIQGLAQLVSGALPSLFGGQLQGSETASQYSMSRAQALQRLQNTWKIFTMWWKEIFGKAIPAFIQEVKEDERNVERNADGNFINTFIRRSELEGKIGQVELE
Ga0318519_1076993613300033290SoilSLIMQTIEHGISQTFADPSVLNFNAYRQIETVPGGIYEANPKTGKSLNEAFYEAKTATLSQEVMPFLNELQSLAQLVSGALPSLFGGAIEGSETASQYSMSRAQALQRLQNNWKTFTIWWKQIFGKVIPMYIKVTKDEGDEKEVQLDKDGNFINVFIRKAELEGKIGRVELEANENLPMTWAQQKDVLMQLLQASN
Ga0316630_1161071713300033487SoilPDGVRIVVVNDAVAEAVVEELDEYWTITYNPLSDFIHFDPIALLLVSIQDITNDLISLTLQTIEHGIPQTFANPKFLDFKAYRNQEAIPGGVYPTIPSSRPVSEGFYEVKTATLSQEVMPFGNKIQELGQLVSGALPSLFGGQMAGSRTASEYSMSRAQALQRLQNTWKILTMWWKNVFGKAIPAYIKLVREDERD
Ga0316630_1222335113300033487SoilNDLVSLTLQTIEHGIPQTFADPTVLDFTAYRQMEVLPGGVYPATPRAGQSVQNGFYEVRTATLSGEVLPFGQNVQQLGQLVSGALPSLFGGQMTESKTASEYAMSRSQALQRLQNVWKMFTVWWKQIFSKVIPAYIKDVQEDEKDVKMDTYGYFVNVFIRKAELEGKI
Ga0364925_0402614_2_5173300034147SedimentTFADPKVLNFSAYRNAEVIPGGIYPASPKTGKPLSEGFYEVKTATLSQEVLPFAEKVQEIGQMVSGALPSLFGGQMSGSRTASEYSMSRAQALQRLQGTWKLLLLWWKNVFGKAIPLYIKVMKDDERSVQKDEFGNFVNVFIRMSELHGKIGSVELEANENLPITWNQQKDA
Ga0364932_0313068_5_5923300034177SedimentMINQEFAEAKNESLDDHWTLTNNPLSDHIHFEPIGLLMTSVQEITNDLISLIIQTIEHGIGQTFFDPRFLNAEAYRQMETVPGGMYATNPIVGGKSIKDGFFEIKTASLSGEVLPFLQKIQEFGQLVTGALPSLFGGLQQGGSNTASEYSMSRAQALQRLQNTWKIFTVWWKTIYGKVIPAYIKTVTEDQKIVQKD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.