NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS019022_WUGC_scaffold_25573

Scaffold SRS019022_WUGC_scaffold_25573


Overview

Basic Information
Taxon OID7000000599 Open in IMG/M
Scaffold IDSRS019022_WUGC_scaffold_25573 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit 2, subject 763961826 replicate 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)51710
Total Scaffold Genes43 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (30.23%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094006Metagenome106Y

Sequences

Protein IDFamilyRBSSequence
SRS019022_WUGC_scaffold_25573__gene_24104F094006GAGGMWSTLEPAGPTGALYEPAVCVEAHIGELQAGSIARRGLFAFGRSNVLAVAELGAKAPHAIDMYDIALCKPLSELFAEELEYAFNFGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.