| Basic Information | |
|---|---|
| Taxon OID | 3300034686 Open in IMG/M |
| Scaffold ID | Ga0334891_013016 Open in IMG/M |
| Source Dataset Name | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_15_08-R1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4401 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Netherlands: Wageningen, Gelderland | |||||||
| Coordinates | Lat. (o) | 51.9691 | Long. (o) | 5.6654 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F075034 | Metagenome / Metatranscriptome | 119 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0334891_013016_454_726 | F075034 | N/A | VYRTVRGNKPACEHLPSEAGLPGRVDRVAACRSCGAPTASSDGICRDCADAMREERAAALGEGCRVHRVRYVEDLPVSVLEEMQAEWGRC |
| ⦗Top⦘ |