Scaffold Ga0334891_005705

Overview

Basic Information

• Taxon OID: 3300034686
• Scaffold ID: Ga0334891_005705
• Source Dataset Name: Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_15_08-R1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8315
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands

Source Dataset Sampling Location

• Location Name: Netherlands: Wageningen, Gelderland
• Coordinates
  • Lat. (^o): 51.9691
  • Long. (^o): 5.6654

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080090	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334891_005705_8193_8315	F080090	GGA	MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDI