NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335061_0020810

Scaffold Ga0335061_0020810


Overview

Basic Information
Taxon OID3300034168 Open in IMG/M
Scaffold IDGa0335061_0020810 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3483
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (92.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005531Metagenome / Metatranscriptome397Y
F063685Metagenome / Metatranscriptome129Y
F085708Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0335061_0020810_2155_2280F085708AGAAGMTTNRILTTLVQLAIGIPALYMARLMWREVLADFREWDKSH
Ga0335061_0020810_2280_2417F063685GAGGMKIELDNYGFMLETEWCYVALSWQLLITTALLVTAYKIYKRKKNK
Ga0335061_0020810_2417_2572F005531AGGAGMTITYSLWQGSQLLSVNNKASNSEEILAVIAELNKLGKGFSFIVREVEVSK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.