Basic Information | |
---|---|
Family ID | F063685 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 46 residues |
Representative Sequence | MTIELDNYGFMLDTEWCYVALSWQLLITTALLVTAYKIYKRKKNK |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 84.38 % |
% of genes near scaffold ends (potentially truncated) | 20.16 % |
% of genes from short scaffolds (< 2000 bps) | 73.64 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (40.310 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (24.806 % of family members) |
Environment Ontology (ENVO) | Unclassified (59.690 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (70.543 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 3.88 |
PF01844 | HNH | 2.33 |
PF13640 | 2OG-FeII_Oxy_3 | 1.55 |
PF01464 | SLT | 1.55 |
PF02867 | Ribonuc_red_lgC | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 59.69 % |
Unclassified | root | N/A | 40.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000206|M3P_c10028971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
3300001282|B570J14230_10061203 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
3300002408|B570J29032_109631346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
3300002835|B570J40625_100322827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1548 | Open in IMG/M |
3300002835|B570J40625_101295957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300003429|JGI25914J50564_10056890 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
3300003430|JGI25921J50272_10017231 | All Organisms → Viruses → Predicted Viral | 2005 | Open in IMG/M |
3300003491|JGI25924J51412_1078179 | Not Available | 501 | Open in IMG/M |
3300003497|JGI25925J51416_10145468 | Not Available | 540 | Open in IMG/M |
3300004795|Ga0007756_11638133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300005069|Ga0071350_1000039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18683 | Open in IMG/M |
3300005517|Ga0070374_10098984 | All Organisms → Viruses → Predicted Viral | 1519 | Open in IMG/M |
3300005517|Ga0070374_10252330 | Not Available | 902 | Open in IMG/M |
3300005517|Ga0070374_10343507 | Not Available | 754 | Open in IMG/M |
3300005517|Ga0070374_10505680 | Not Available | 603 | Open in IMG/M |
3300005517|Ga0070374_10518275 | Not Available | 594 | Open in IMG/M |
3300005528|Ga0068872_10378234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300005580|Ga0049083_10086196 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
3300005583|Ga0049085_10076889 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
3300005583|Ga0049085_10168953 | Not Available | 733 | Open in IMG/M |
3300005662|Ga0078894_10932599 | Not Available | 751 | Open in IMG/M |
3300005662|Ga0078894_11554637 | Not Available | 547 | Open in IMG/M |
3300005662|Ga0078894_11563869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300005662|Ga0078894_11566857 | Not Available | 545 | Open in IMG/M |
3300005940|Ga0073913_10007645 | Not Available | 1434 | Open in IMG/M |
3300006484|Ga0070744_10212965 | Not Available | 549 | Open in IMG/M |
3300006484|Ga0070744_10230069 | Not Available | 525 | Open in IMG/M |
3300006639|Ga0079301_1008078 | All Organisms → Viruses → Predicted Viral | 4055 | Open in IMG/M |
3300007545|Ga0102873_1119120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
3300007600|Ga0102920_1063527 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
3300007621|Ga0102872_1144095 | Not Available | 632 | Open in IMG/M |
3300007624|Ga0102878_1173169 | Not Available | 623 | Open in IMG/M |
3300007634|Ga0102901_1114500 | Not Available | 769 | Open in IMG/M |
3300007639|Ga0102865_1107028 | Not Available | 836 | Open in IMG/M |
3300007644|Ga0102902_1206383 | Not Available | 579 | Open in IMG/M |
3300007653|Ga0102868_1016965 | All Organisms → Viruses → Predicted Viral | 1520 | Open in IMG/M |
3300007706|Ga0102899_1194863 | Not Available | 511 | Open in IMG/M |
3300007992|Ga0105748_10444556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300008021|Ga0102922_1055144 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
3300008107|Ga0114340_1006151 | Not Available | 6321 | Open in IMG/M |
3300008107|Ga0114340_1054437 | All Organisms → Viruses → Predicted Viral | 1740 | Open in IMG/M |
3300008107|Ga0114340_1075211 | Not Available | 2420 | Open in IMG/M |
3300008107|Ga0114340_1267471 | Not Available | 510 | Open in IMG/M |
3300008113|Ga0114346_1066746 | Not Available | 1737 | Open in IMG/M |
3300008261|Ga0114336_1047133 | All Organisms → Viruses → Predicted Viral | 3189 | Open in IMG/M |
3300008261|Ga0114336_1235777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1607 | Open in IMG/M |
3300009026|Ga0102829_1329070 | Not Available | 512 | Open in IMG/M |
3300009056|Ga0102860_1031883 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
3300009068|Ga0114973_10036456 | All Organisms → Viruses → Predicted Viral | 2951 | Open in IMG/M |
3300009068|Ga0114973_10054981 | All Organisms → Viruses → Predicted Viral | 2341 | Open in IMG/M |
3300009152|Ga0114980_10216460 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
3300009155|Ga0114968_10005401 | Not Available | 9486 | Open in IMG/M |
3300009158|Ga0114977_10705350 | Not Available | 537 | Open in IMG/M |
3300009159|Ga0114978_10744492 | Not Available | 556 | Open in IMG/M |
3300009161|Ga0114966_10008135 | Not Available | 8556 | Open in IMG/M |
3300009161|Ga0114966_10098304 | All Organisms → Viruses → Predicted Viral | 1972 | Open in IMG/M |
3300009161|Ga0114966_10251577 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
3300009163|Ga0114970_10373283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300009164|Ga0114975_10610130 | Not Available | 581 | Open in IMG/M |
3300009164|Ga0114975_10729210 | Not Available | 522 | Open in IMG/M |
3300009180|Ga0114979_10049099 | All Organisms → Viruses → Predicted Viral | 2647 | Open in IMG/M |
3300009181|Ga0114969_10602074 | Not Available | 602 | Open in IMG/M |
3300009184|Ga0114976_10121355 | Not Available | 1479 | Open in IMG/M |
3300009184|Ga0114976_10124632 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
3300009194|Ga0114983_1010575 | All Organisms → Viruses → Predicted Viral | 2716 | Open in IMG/M |
3300010160|Ga0114967_10650101 | Not Available | 503 | Open in IMG/M |
3300010388|Ga0136551_1000342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13666 | Open in IMG/M |
3300010388|Ga0136551_1034794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 942 | Open in IMG/M |
3300010885|Ga0133913_11399032 | All Organisms → Viruses → Predicted Viral | 1779 | Open in IMG/M |
3300010885|Ga0133913_13078768 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
3300012286|Ga0157137_105327 | Not Available | 842 | Open in IMG/M |
3300012665|Ga0157210_1005903 | All Organisms → Viruses → Predicted Viral | 2427 | Open in IMG/M |
3300012766|Ga0138282_1181201 | Not Available | 501 | Open in IMG/M |
3300013004|Ga0164293_10850797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300013295|Ga0170791_15498473 | Not Available | 740 | Open in IMG/M |
3300020141|Ga0211732_1175929 | Not Available | 9869 | Open in IMG/M |
3300020151|Ga0211736_10320388 | Not Available | 517 | Open in IMG/M |
3300020498|Ga0208050_1027233 | Not Available | 575 | Open in IMG/M |
3300020531|Ga0208487_1013759 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
3300020549|Ga0207942_1000383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11521 | Open in IMG/M |
3300020560|Ga0208852_1050071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300020562|Ga0208597_1025310 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
3300021602|Ga0194060_10146008 | All Organisms → Viruses → Predicted Viral | 1258 | Open in IMG/M |
3300021961|Ga0222714_10121677 | All Organisms → Viruses → Predicted Viral | 1610 | Open in IMG/M |
3300021962|Ga0222713_10098711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2097 | Open in IMG/M |
3300023174|Ga0214921_10311759 | Not Available | 867 | Open in IMG/M |
3300023184|Ga0214919_10596967 | Not Available | 652 | Open in IMG/M |
3300024343|Ga0244777_10022378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3998 | Open in IMG/M |
3300024346|Ga0244775_10042034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4020 | Open in IMG/M |
3300024348|Ga0244776_10239167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1269 | Open in IMG/M |
3300027114|Ga0208009_1004072 | All Organisms → Viruses → Predicted Viral | 3941 | Open in IMG/M |
3300027141|Ga0255076_1080997 | Not Available | 531 | Open in IMG/M |
3300027365|Ga0209300_1010403 | All Organisms → Viruses → Predicted Viral | 2530 | Open in IMG/M |
3300027531|Ga0208682_1019419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1859 | Open in IMG/M |
3300027597|Ga0255088_1071916 | Not Available | 655 | Open in IMG/M |
3300027627|Ga0208942_1003166 | Not Available | 5758 | Open in IMG/M |
3300027627|Ga0208942_1068101 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
3300027631|Ga0208133_1027062 | All Organisms → Viruses → Predicted Viral | 1450 | Open in IMG/M |
3300027644|Ga0209356_1001711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8530 | Open in IMG/M |
3300027656|Ga0209357_1083191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300027689|Ga0209551_1018533 | All Organisms → Viruses → Predicted Viral | 2368 | Open in IMG/M |
3300027710|Ga0209599_10002377 | Not Available | 7815 | Open in IMG/M |
3300027710|Ga0209599_10009316 | All Organisms → Viruses → Predicted Viral | 3078 | Open in IMG/M |
3300027734|Ga0209087_1082481 | All Organisms → Viruses → Predicted Viral | 1395 | Open in IMG/M |
3300027736|Ga0209190_1245771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
3300027754|Ga0209596_1001217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 22549 | Open in IMG/M |
3300027754|Ga0209596_1005319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9543 | Open in IMG/M |
3300027754|Ga0209596_1037737 | All Organisms → Viruses → Predicted Viral | 2647 | Open in IMG/M |
3300027756|Ga0209444_10156397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
3300027759|Ga0209296_1084302 | All Organisms → Viruses → Predicted Viral | 1557 | Open in IMG/M |
3300027760|Ga0209598_10144793 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
3300027769|Ga0209770_10388925 | Not Available | 517 | Open in IMG/M |
3300027770|Ga0209086_10168885 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
3300027782|Ga0209500_10041994 | All Organisms → Viruses → Predicted Viral | 2500 | Open in IMG/M |
3300027782|Ga0209500_10064492 | All Organisms → Viruses → Predicted Viral | 1905 | Open in IMG/M |
3300027892|Ga0209550_10395470 | Not Available | 857 | Open in IMG/M |
3300027892|Ga0209550_10409924 | Not Available | 836 | Open in IMG/M |
3300027963|Ga0209400_1191660 | Not Available | 854 | Open in IMG/M |
3300027969|Ga0209191_1198481 | Not Available | 791 | Open in IMG/M |
3300028025|Ga0247723_1008491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4229 | Open in IMG/M |
3300028025|Ga0247723_1029474 | All Organisms → Viruses → Predicted Viral | 1747 | Open in IMG/M |
3300031784|Ga0315899_11318532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300034050|Ga0335023_0420109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300034066|Ga0335019_0509697 | Not Available | 717 | Open in IMG/M |
3300034101|Ga0335027_0003920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13087 | Open in IMG/M |
3300034101|Ga0335027_0337047 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
3300034102|Ga0335029_0147469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1613 | Open in IMG/M |
3300034168|Ga0335061_0020810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3483 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 24.81% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.83% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 11.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.98% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.20% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.43% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.65% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.10% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.33% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.55% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.55% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.55% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.55% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.55% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.78% |
Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.78% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.78% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000206 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012286 | Freshwater microbial communities from Ausable River, Ontario, Canada - S47 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012766 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020531 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
M3P_100289713 | 3300000206 | Lotic | MTIELDNYGLMLDTEWCYIALSWQLLITTALVAVGYKVYKKWKTKNDK* |
B570J14230_100612035 | 3300001282 | Freshwater | MTIELDNYGFMLDTEWCYVALSWQLLITTTLLVTAYKIYKRKKNK* |
B570J29032_1096313463 | 3300002408 | Freshwater | DTYGFMLDTEWAYVALSWQLLITSALLITAYKIYKIYLKRNGLVGWNY* |
B570J40625_1003228274 | 3300002835 | Freshwater | MSEGFFTIELGRYGFMFDTEWCYVAISWQLIITSALVFAGYKFYKRKKITK* |
B570J40625_1012959572 | 3300002835 | Freshwater | MTIEIDTYGFMLDTEWAYVALSWQLLITSALLITAYKIYKIYLKRNGLVGWNY* |
JGI25914J50564_100568901 | 3300003429 | Freshwater Lake | MTIELDNYGFMLDTEWCYIALSWQLLITTALLAVGYKYYKKWKTKNVK* |
JGI25921J50272_100172313 | 3300003430 | Freshwater Lake | MLSIELDNYGFMLDTEWCYIALSWQLLATAVLLGVGYKYYKKWKNTNDK* |
JGI25924J51412_10781792 | 3300003491 | Freshwater Lake | MIIELDTYGFMFDTEWAYVSLSWQLLITSALLGIAYKFYLVRKAK* |
JGI25925J51416_101454682 | 3300003497 | Freshwater Lake | MKIELDXFGFMFNTEWAYVSLSWELLIASVLLGVAYKFYKIRKGK* |
Ga0007756_116381331 | 3300004795 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVALSWQLLITTALLITAYKIYKRKKNK* |
Ga0071350_100003912 | 3300005069 | Freshwater | MTIELDNYGFMLDTEWCYIALSWQLLITAGVIFAGYKAYKKWKTTNDN* |
Ga0070374_100989843 | 3300005517 | Freshwater Lake | MKIELDNYGFMLETEWCYVALSWQLLITTALLLTAYKVYKRMRVK* |
Ga0070374_102523304 | 3300005517 | Freshwater Lake | MTIELDNYGFMLDTEWCYVALSWQLLITTALLVTAYKIYKRKKNK* |
Ga0070374_103435074 | 3300005517 | Freshwater Lake | ELDNYGFMLDTEWCYVALSWQLLITTALLVTAYKIYKRKKNK* |
Ga0070374_105056801 | 3300005517 | Freshwater Lake | MTIELDQYGLMIDTELFYIALTWQIMITTALVITAYKIYKRKKNK* |
Ga0070374_105182751 | 3300005517 | Freshwater Lake | MTIELDNYGFMLDTEWCYIALSWQLLITAGVIFAGYKAYKKWKTNNDK* |
Ga0068872_103782344 | 3300005528 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVALSWQLLITSALLGIAYKIYKRKKNK* |
Ga0049083_100861964 | 3300005580 | Freshwater Lentic | MSEGFFTIEVDTYGFMLDSAWCYVALSWQLLITTTLLITAYKIYKRKKNK* |
Ga0049085_100768891 | 3300005583 | Freshwater Lentic | MKIELDSFGFMFNTEWAYVSLSWELLIVSVLLGVAYKFYKVRK |
Ga0049085_101689532 | 3300005583 | Freshwater Lentic | MTIELDTYGFMFDTEWAYVSLSWQLLITSALLGIVYKFYKVRKGK* |
Ga0078894_109325993 | 3300005662 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVALSWQLLITSALLGIAYKFYLVRKAK* |
Ga0078894_115546372 | 3300005662 | Freshwater Lake | MKIELDNYGFMLETEWCYVALSWQLLITTALLLTAYKIYKRKKNK* |
Ga0078894_115638693 | 3300005662 | Freshwater Lake | MTIELDNYGFMLDTEWCYIALSWQLLITTALLAVGYKYY |
Ga0078894_115668572 | 3300005662 | Freshwater Lake | LQCKRGRGKVMKIELDNYGFMLETEWCYVALSWQLLITSALLLTAYKVYKRMRVK* |
Ga0073913_100076453 | 3300005940 | Sand | MNEGFFTIEIGSYGFMLDTKWCYIALSWQLIITATLLTIAYKIYKRKKNK* |
Ga0070744_102129652 | 3300006484 | Estuarine | MKIELDSFGFMFNTEWAYVSLSWELLIVSVLLGVAYKFYKIRKGK* |
Ga0070744_102300693 | 3300006484 | Estuarine | MTIELDNYGFMLDTEWAYVALSWQLLITTALVITAYKIYKIKRGK* |
Ga0079301_10080785 | 3300006639 | Deep Subsurface | MSEGFFTIEVDTYGFMLDSAWCYVALSWQLLITTTLLITAYKIYKIRKNK* |
Ga0102873_11191201 | 3300007545 | Estuarine | YGFMLDTEWCYIALSWQLLITTALLAVGYKYYKKWKTKNVK* |
Ga0102920_10635273 | 3300007600 | Estuarine | MTIELDNYGFMLDTEWCYIALSWQLLITTALLAVGYKYYKKWKTK |
Ga0102872_11440952 | 3300007621 | Estuarine | MTIELDTYGFMFDTEWAYVALSWQLLITTALVVVAYKAYKKWGNRK* |
Ga0102878_11731691 | 3300007624 | Estuarine | MTIELDNYGFMLDTEWAYVALSWQLLITTALVAVAYKAYKKWGNRK* |
Ga0102901_11145002 | 3300007634 | Estuarine | MKIELDSYGFMFNTEWAYVSLSWELLIVSVLLGVAYKFYKIRKGK* |
Ga0102865_11070282 | 3300007639 | Estuarine | MTIELDTYGFMFDTEWAYVALSWQLLITTALVITAYKIYKIKRGK* |
Ga0102902_12063831 | 3300007644 | Estuarine | IELDNYGFMLDTEWCYIALSWQLLITAGVIFAGYKAYKKWKTTNDN* |
Ga0102868_10169652 | 3300007653 | Estuarine | MTIELDNYGFMLDTEWCYIALSWQLLITTALVAVGYKYYKKWKTKNVK* |
Ga0102899_11948632 | 3300007706 | Estuarine | NYGFMLDTEWCYIALSWQLLITAGVIFAGYKAYKKWKTTNDN* |
Ga0105748_104445563 | 3300007992 | Estuary Water | MTIELDNYGFMLDTEWAYVALSWQLLITSALLGIAYKFYLVRRAK* |
Ga0102922_10551444 | 3300008021 | Estuarine | MTIELENYGFMLDTEWCYIALSWQLLITTALLAVGYKYYKKWKTKNVK* |
Ga0114340_10061511 | 3300008107 | Freshwater, Plankton | MSEGFFTIELGRYGFMFDTNWSYVAISWELIIISALVFAGYKFYKRKKITK* |
Ga0114340_10544371 | 3300008107 | Freshwater, Plankton | MTIEIDTYGFMLDTEWAYVALSWQLLITTALLITAYKIYKRKKITK* |
Ga0114340_10752117 | 3300008107 | Freshwater, Plankton | MSEGILTIELDSYGFLFDTQWCYVALSWQLLAITALVVIGYKIYKRRKGK* |
Ga0114340_12674711 | 3300008107 | Freshwater, Plankton | LTIELDSYGFMLDTELCYVALSWGLIIPAVILVVAYKIYKRRKGK* |
Ga0114346_10667466 | 3300008113 | Freshwater, Plankton | TELMTIELDNYGFMLDTEWCYIALSWQLLITAGVIFAGYKAYKKWKIKNDN* |
Ga0114336_10471332 | 3300008261 | Freshwater, Plankton | MTLELDNYGLMLDTEWAYIALSWPLLITAGVIFAGYKAYKKWKTTNDK* |
Ga0114336_12357773 | 3300008261 | Freshwater, Plankton | MTIELDNYGFMLDTEWCYIALSWQLLITAGVIFAGYKAYKKWKIKNDN* |
Ga0102829_13290701 | 3300009026 | Estuarine | MKIELDSFGFMFNTEWAYVSLSWELLIVSVLLGVAYKFYKVRKAK* |
Ga0102860_10318835 | 3300009056 | Estuarine | MTIEIDTYGFMLDTEWAYVALSWQLLITSALLGIAYKFYKIRKAK* |
Ga0114973_100364562 | 3300009068 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVALSWQLLITSALLITAYKIYKIKRGK* |
Ga0114973_100549813 | 3300009068 | Freshwater Lake | MTIELGDYGFMLDTEWAYVALSWQLLITSALLGIAYKFYLIRKAK* |
Ga0114980_102164604 | 3300009152 | Freshwater Lake | MTIEIDNYGFMLDTEWAYVALSWQLLISTALLITAYKIYKIKRGK* |
Ga0114968_1000540125 | 3300009155 | Freshwater Lake | MKIELDSFGFMFNTEWAYVSLSWELLIASVLLGVAYKFYKIRKAK* |
Ga0114977_107053503 | 3300009158 | Freshwater Lake | MTIELDTYGFMLDTEWAYVALSWQLLITSALLGIAYKFYLVRKAK* |
Ga0114978_107444922 | 3300009159 | Freshwater Lake | DTYGFMLDTEWAYVALSWQLLITSALLGIAYKFYLVRKAK* |
Ga0114966_1000813514 | 3300009161 | Freshwater Lake | MTIELDDYGFMFDTEWCYVALSWQLLIITALLAVAYKAYKKWGNRK* |
Ga0114966_100983041 | 3300009161 | Freshwater Lake | YGFMLDTEWAYVALSWQLLITSALLGIAYKFYLIRKAK* |
Ga0114966_102515772 | 3300009161 | Freshwater Lake | MTIELDNYGFMLDTEWCYVALSWQLLITTALLITAYKIYKIKRGK* |
Ga0114970_103732831 | 3300009163 | Freshwater Lake | RLE*LMKIELDSFGFMFNTEWAYVSLSWELLIASVLLGVAYKFYKIRKAK* |
Ga0114975_106101302 | 3300009164 | Freshwater Lake | DTYGFMLDTEWAYVALSWQLLITTALLITAYKIYKRKKNK* |
Ga0114975_107292101 | 3300009164 | Freshwater Lake | TYGFMLDTEWAYVALSWQLLITTALLITAYKIYKIKRGK* |
Ga0114979_100490998 | 3300009180 | Freshwater Lake | MTIEIDNYGFMLDTEWAYVALSWQLLITTALLITAYKIYKRKKNK* |
Ga0114969_106020742 | 3300009181 | Freshwater Lake | MTIELDTYGFMFDTEWAYIALSWQLLITTALVAVAYKAYKKWGNRK* |
Ga0114976_101213551 | 3300009184 | Freshwater Lake | TYGFMLDTEWAYVALSWQLLITTALLITAYKIYKRKKNK* |
Ga0114976_101246321 | 3300009184 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVALSWQLLITTALLITAYKIYKIKRGK* |
Ga0114983_10105751 | 3300009194 | Deep Subsurface | MSEGILTIELGRYGFMLDTEWCYIALSWELLAATTLLTIAYKIYKRKKNK* |
Ga0114967_106501012 | 3300010160 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVALSWQLLITTALLGIAYKFYLVRKAK* |
Ga0136551_100034232 | 3300010388 | Pond Fresh Water | MSEGFFTIEIDNYGFMLDTEWAYIALSWQLLTLTALVVIGYKIYKRKKNK* |
Ga0136551_10347942 | 3300010388 | Pond Fresh Water | MSEGILTIELGRYGFMLDTEWCYVALSWELLATTTLLLIAYKIYKRKKNK* |
Ga0133913_113990322 | 3300010885 | Freshwater Lake | MTIELDDYGFMLDTEWCYVALSWQLLITATLLTIGYLVYKRKKNK* |
Ga0133913_130787684 | 3300010885 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVAISWQLLITTALLVVAYKVYKWKRGK* |
Ga0157137_1053271 | 3300012286 | Freshwater | MSEGILTIELGRYGFMLDTEWCYVALSWELLFTTTLLTIAYKIYKRKKNK* |
Ga0157210_10059035 | 3300012665 | Freshwater | MLTIELDSYGFMLDTNWAYIALSWQLLATAVILGVGYKYFKKWKNTNDK* |
Ga0138282_11812012 | 3300012766 | Freshwater Lake | MTIELDNYGFMLDTEWAYVALSWQLLITTALLGIAYKFYLVRKAK* |
Ga0164293_108507971 | 3300013004 | Freshwater | MSEGFFVIELGRYGFMLDTEWCYVAISWQLIITSALVFAGYKFYKRKKITK* |
Ga0170791_154984733 | 3300013295 | Freshwater | TIEIDTYGFMLDTEWAYVALSWQLLITSALLGIAYKFYLVRKAK* |
Ga0211732_11759292 | 3300020141 | Freshwater | MTIELDQYGFMLDTEWAYVALSWQLLITTALLVTAYKIYKRKKNK |
Ga0211736_103203882 | 3300020151 | Freshwater | MTIELDEYGFMLDTEWAYVALSWQLLITTALLLTAYKIYKRKKNK |
Ga0208050_10272331 | 3300020498 | Freshwater | MNEGIFTIEIGSYGFMLDTNWCYIALSWQLIITLSLLTIAYKVY |
Ga0208487_10137591 | 3300020531 | Freshwater | MTIEIDTYGFMLDTEWAYVALSWQLLITSALLITAYKIYKIYLKRNGLVGWNY |
Ga0207942_100038330 | 3300020549 | Freshwater | MTIELDNYGFMLDTEWCYVALSWQLLITTTLLVTAYKIYKRKKNK |
Ga0208852_10500712 | 3300020560 | Freshwater | MSEGFFTIELGRYGFMFDTEWCYVAISWQLIITSALVFAGYKFYKRKKITK |
Ga0208597_10253104 | 3300020562 | Freshwater | MKIELDNYGFMLETEWCYVALSWQLLITTALLLTAYKIYKRKKNK |
Ga0194060_101460083 | 3300021602 | Anoxic Zone Freshwater | MTLELNGYGLELDTNWCYVALSWQLLITTALLITAYKIYKIKRGK |
Ga0222714_101216771 | 3300021961 | Estuarine Water | MSEGIFTIELGRYGFMLDTEWAYVSLSWELLTISALLTIAYKIYKRKKNK |
Ga0222713_100987115 | 3300021962 | Estuarine Water | MNEGLLTIELGRYGFMLDTEWCYIALSWELITTSALLTIAYKIYKRKKNK |
Ga0214921_103117592 | 3300023174 | Freshwater | MTLELNGYGLELDTNWCYVALSWQLLITSALLITAYKIYKIKRGK |
Ga0214919_105969672 | 3300023184 | Freshwater | MTIEIDTYGFMLDTEWAYVALSWQLLITSALLITAYKIYKIKRGK |
Ga0244777_100223785 | 3300024343 | Estuarine | MTIELDNYGFMLDTEWCYIALSWQLLITTALLAVGYKYYKKWKTKNVK |
Ga0244775_100420347 | 3300024346 | Estuarine | MNEGFFTIEIGSYGFMLDTKWCYIALSWQLIITATLLTIAYKIYKRKKNK |
Ga0244776_102391675 | 3300024348 | Estuarine | MKIELDSYGFMFNTEWAYVSLSWELLIVSVLLGVAYKFYKIRKGK |
Ga0208009_100407213 | 3300027114 | Deep Subsurface | MSEGFFTIEVDTYGFMLDSAWCYVALSWQLLITTTLLITAYKIYKIRKNK |
Ga0255076_10809971 | 3300027141 | Freshwater | FGFMFNTEWAYVSLSWELLIVSVLLGVAYKFYKVRKAK |
Ga0209300_10104032 | 3300027365 | Deep Subsurface | MSEGILTIELGRYGFMLDTEWCYIALSWELLAATTLLTIAYKIYKRKKNK |
Ga0208682_10194191 | 3300027531 | Estuarine | MTIELDNYGFMLDTEWCYIALSWQLLITAGVIFAGYKAYK |
Ga0255088_10719161 | 3300027597 | Freshwater | MKIELDSFGFMFNTEWAYVSLSWELLIVSVLLGVAYKIYK |
Ga0208942_10031662 | 3300027627 | Freshwater Lentic | MTIELDTYGFMFDTEWAYVSLSWQLLITSALLGIVYKFYKVRKGK |
Ga0208942_10681011 | 3300027627 | Freshwater Lentic | MKIELDSFGFMFNTEWAYVSLSWELLIVSVLLGVAYKFYKVRKGK |
Ga0208133_10270622 | 3300027631 | Estuarine | MTIELDNYGFMLDTEWAYVALSWQLLITTALVITAYKIYKIKRGK |
Ga0209356_10017112 | 3300027644 | Freshwater Lake | MIIELDTYGFMFDTEWAYVSLSWQLLITSALLGIAYKFYLVRKAK |
Ga0209357_10831914 | 3300027656 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVALSWQLLITSALLGIAYKFYLVRKAK |
Ga0209551_10185335 | 3300027689 | Freshwater Lake | MKIELDNYGFMLETEWCYVALSWQLLITTALLLTAYKVYKRMRVK |
Ga0209599_100023777 | 3300027710 | Deep Subsurface | MSEGFFTIELGRYGFMFDTNWSYVAISWELIIISALVFAGYKFYKRKKITK |
Ga0209599_100093164 | 3300027710 | Deep Subsurface | MTIELDDYGFMLDTEWCYVALSWQLLITATLLTIGYLVYKRKKNK |
Ga0209087_10824812 | 3300027734 | Freshwater Lake | MTIELDTYGFMLDTEWAYVALSWQLLITSALLGIAYKFYLVRKAK |
Ga0209190_12457711 | 3300027736 | Freshwater Lake | XLMKIELDSFGFMFNTEWAYVSLSWELLIASVLLGVAYKFYKIRKAK |
Ga0209596_100121731 | 3300027754 | Freshwater Lake | MKIELDSFGFMFNTEWAYVSLSWELLIASVLLGVAYKFYKIRKAK |
Ga0209596_100531918 | 3300027754 | Freshwater Lake | MTIELDTYGFMFDTEWAYIALSWQLLITTALVAVAYKAYKKWGNRK |
Ga0209596_10377375 | 3300027754 | Freshwater Lake | MTIELDNYGFMLDTEWCYVALSWQLLITTALLITAYKIYKIKRGK |
Ga0209444_101563972 | 3300027756 | Freshwater Lake | MKIELDGFGFMFNTEWAYVSLSWELLIASVLLGVAYKFYKIRKGK |
Ga0209296_10843022 | 3300027759 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVALSWQLLITTALLITAYKIYKIKRGK |
Ga0209598_101447932 | 3300027760 | Freshwater Lake | MTIELGDYGFMLDTEWAYVALSWQLLITSALLGIAYKFYLIRKAK |
Ga0209770_103889252 | 3300027769 | Freshwater Lake | MTIELDNYGFMLDTEWCYIALSWQLLATTVLLGVGYKYYKKWKNTNDK |
Ga0209086_101688855 | 3300027770 | Freshwater Lake | MTIELDDYGFMFDTEWCYVALSWQLLIITALLAVAYKAYKKWGNRK |
Ga0209500_100419944 | 3300027782 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVALSWQLLITTALLITAYKIYKRKKNK |
Ga0209500_100644929 | 3300027782 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVALSWQLLITSALLGIAYKVYLVRKAK |
Ga0209550_101047481 | 3300027892 | Freshwater Lake | MNEGIFTIELGSYGFMLDTKWCYIALSWQLIITATLLTIGYK |
Ga0209550_103954702 | 3300027892 | Freshwater Lake | MTIELDNYGFMLDTEWCYIALSWQLLITAGVIFAGYKAYKKWKTNNDK |
Ga0209550_104099242 | 3300027892 | Freshwater Lake | MLSIELDNYGFMLDTEWCYIALSWQLLATAVLLGVGYKYYKKWKNTNDK |
Ga0209400_11916603 | 3300027963 | Freshwater Lake | MTIEIDTYGFMLDTEWAYVALSWQLLITTALLGIAYKFYLVRKAK |
Ga0209191_11984811 | 3300027969 | Freshwater Lake | DTYGFMLDTEWAYVALSWQLLITSALLITAYKIYKIKRGK |
Ga0247723_100849110 | 3300028025 | Deep Subsurface Sediment | MSEGFFTIELGRYGFMLDTEWCYVAISWQLIITSALVFAGYKFYKRKKITK |
Ga0247723_10294742 | 3300028025 | Deep Subsurface Sediment | MTIELDTYGFMFDTEWAYIALSWELLITSAVIATAYLAFKKWSNRK |
Ga0315899_113185322 | 3300031784 | Freshwater | MSEGILTIELDSYGFMLDTELCYVALSWGLIIPAVILVVAYKIYKRRKGK |
Ga0335023_0420109_3_146 | 3300034050 | Freshwater | MTIEIDTYGFMLDTEWAYVALSWQLLITSALLITAYKIYKIYLKRNGL |
Ga0335019_0509697_494_631 | 3300034066 | Freshwater | MTIELDNYGFMLDTEWCYVALSWQLLITTALLVTAYKIYKRKKNK |
Ga0335027_0003920_1105_1245 | 3300034101 | Freshwater | MIIELDNYGFMLETEWCYVALSWQLLLTTALLITAYKIYKRKKITK |
Ga0335027_0337047_782_916 | 3300034101 | Freshwater | MTIEIDTYGFMLDTEWAYVALSWQLLITTALLITAYKIYKRFYK |
Ga0335029_0147469_388_543 | 3300034102 | Freshwater | MSEGFFTIELGRYGFMLDTEWCYVAISWQLIITSALVFAGYKFYKRKKISK |
Ga0335061_0020810_2280_2417 | 3300034168 | Freshwater | MKIELDNYGFMLETEWCYVALSWQLLITTALLVTAYKIYKRKKNK |
⦗Top⦘ |