Metagenome / Metatranscriptome Family F085708

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F085708
Family Type	Metagenome / Metatranscriptome
Number of Sequences	111
Average Sequence Length	39 residues
Representative Sequence	MNRLLTTLVQLALAIPALYMGRMMWREIVADFREWDKSH
Number of Associated Samples	74
Number of Associated Scaffolds	111

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	88.29 %
% of genes near scaffold ends (potentially truncated)	9.91 %
% of genes from short scaffolds (< 2000 bps)	53.15 %
Associated GOLD sequencing projects	61
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Predicted Viral (42.342 % of family members)
NCBI Taxonomy ID	10239 (predicted)
Taxonomy	All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.523 % of family members)
Environment Ontology (ENVO)	Unclassified (51.351 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (54.054 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.53
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 111 Family Scaffolds
PF06067	DUF932	10.81
PF04488	Gly_transf_sug	1.80
PF13640	2OG-FeII_Oxy_3	1.80
PF01464	SLT	1.80
PF11397	GlcNAc	1.80
PF04860	Phage_portal	1.80
PF08241	Methyltransf_11	0.90
PF04973	NMN_transporter	0.90
PF14579	HHH_6	0.90
PF07463	NUMOD4	0.90
PF03567	Sulfotransfer_2	0.90

COG ID	Name	Functional Category	% Frequency in 111 Family Scaffolds
COG3774	Mannosyltransferase OCH1 or related enzyme	Cell wall/membrane/envelope biogenesis [M]	1.80
COG3201	Nicotinamide riboside transporter PnuC	Coenzyme transport and metabolism [H]	0.90

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	64.86 %
Unclassified	root	N/A	35.14 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	63.06 %
Unclassified	root	N/A	35.14 %
cellular organisms	root	All Organisms → cellular organisms	1.80 %

Name	Rank	Taxonomy	Distribution
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	42.34 %
Unclassified	root	N/A	35.14 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	18.92 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.80 %

Name	Rank	Taxonomy	Distribution
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	42.34 %
Unclassified	root	N/A	35.14 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	18.92 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.90 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.90 %

Name	Rank	Taxonomy	Distribution
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	42.34 %
Unclassified	root	N/A	35.14 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	18.92 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.90 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.90 %

Name	Rank	Taxonomy	Distribution
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	42.34 %
Unclassified	root	N/A	35.14 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	18.92 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.90 %
Neisseriales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales	0.90 %

Name	Rank	Taxonomy	Distribution
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	42.34 %
Unclassified	root	N/A	35.14 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	16.22 %
Neisseriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae	0.90 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.90 %

Name	Rank	Taxonomy	Distribution
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	42.34 %
Unclassified	root	N/A	35.14 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16.22 %
Eikenella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Eikenella	0.90 %
Aphanizomenonaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae	0.90 %

Name	Rank	Taxonomy	Distribution
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	42.34 %
Unclassified	root	N/A	35.14 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16.22 %
unclassified Eikenella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Eikenella → unclassified Eikenella	0.90 %
Aphanizomenon	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon	0.90 %

Name	Rank	Taxonomy	Distribution
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	42.34 %
Unclassified	root	N/A	35.14 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16.22 %
Eikenella sp. HMSC061C02	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Eikenella → unclassified Eikenella → Eikenella sp. HMSC061C02	0.90 %
Aphanizomenon flos-aquae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae	0.90 %

Name	Rank	Taxonomy	Distribution
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	42.34 %
Unclassified	root	N/A	35.14 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16.22 %
Aphanizomenon flos-aquae WA102	isolate	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	0.90 %
Eikenella sp. HMSC061C02	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Eikenella → unclassified Eikenella → Eikenella sp. HMSC061C02	0.90 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352004\|2199788704	All Organisms → Viruses → Predicted Viral	2206	Open in IMG/M
3300000756\|JGI12421J11937_10019815	All Organisms → Viruses → Predicted Viral	2488	Open in IMG/M
3300000882\|FwDRAFT_10078009	All Organisms → Viruses → Predicted Viral	1585	Open in IMG/M
3300003277\|JGI25908J49247_10002632	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5739	Open in IMG/M
3300003413\|JGI25922J50271_10002987	Not Available	4883	Open in IMG/M
3300003430\|JGI25921J50272_10001498	Not Available	7853	Open in IMG/M
3300003430\|JGI25921J50272_10113372	Not Available	572	Open in IMG/M
3300004054\|Ga0063232_10125947	Not Available	735	Open in IMG/M
3300004112\|Ga0065166_10331705	Not Available	626	Open in IMG/M
3300004124\|Ga0066178_10165556	Not Available	627	Open in IMG/M
3300005069\|Ga0071350_1119829	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	838	Open in IMG/M
3300005517\|Ga0070374_10061540	All Organisms → Viruses → Predicted Viral	1955	Open in IMG/M
3300005517\|Ga0070374_10252330	Not Available	902	Open in IMG/M
3300005517\|Ga0070374_10311376	Not Available	799	Open in IMG/M
3300005585\|Ga0049084_10045449	All Organisms → Viruses → Predicted Viral	1668	Open in IMG/M
3300005662\|Ga0078894_10159549	Not Available	2030	Open in IMG/M
3300005662\|Ga0078894_10241008	All Organisms → Viruses → Predicted Viral	1639	Open in IMG/M
3300005662\|Ga0078894_10429661	All Organisms → Viruses → Predicted Viral	1191	Open in IMG/M
3300005662\|Ga0078894_10435368	Not Available	1182	Open in IMG/M
3300005662\|Ga0078894_10464445	All Organisms → Viruses → Predicted Viral	1139	Open in IMG/M
3300005662\|Ga0078894_10467895	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1134	Open in IMG/M
3300005662\|Ga0078894_10519729	All Organisms → Viruses → Predicted Viral	1067	Open in IMG/M
3300005662\|Ga0078894_10662683	Not Available	924	Open in IMG/M
3300005662\|Ga0078894_10789673	Not Available	831	Open in IMG/M
3300005662\|Ga0078894_11163041	Not Available	655	Open in IMG/M
3300005662\|Ga0078894_11171336	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	652	Open in IMG/M
3300005662\|Ga0078894_11655438	Not Available	526	Open in IMG/M
3300005941\|Ga0070743_10039824	Not Available	1610	Open in IMG/M
3300005941\|Ga0070743_10046704	All Organisms → Viruses → Predicted Viral	1479	Open in IMG/M
3300005941\|Ga0070743_10078903	All Organisms → Viruses → Predicted Viral	1112	Open in IMG/M
3300006484\|Ga0070744_10013004	All Organisms → Viruses → Predicted Viral	2469	Open in IMG/M
3300006484\|Ga0070744_10028287	All Organisms → Viruses → Predicted Viral	1660	Open in IMG/M
3300006484\|Ga0070744_10041821	All Organisms → Viruses → Predicted Viral	1348	Open in IMG/M
3300006484\|Ga0070744_10130596	Not Available	722	Open in IMG/M
3300006484\|Ga0070744_10201258	Not Available	566	Open in IMG/M
3300006639\|Ga0079301_1030713	All Organisms → Viruses → Predicted Viral	1815	Open in IMG/M
3300006641\|Ga0075471_10072734	Not Available	1877	Open in IMG/M
3300006641\|Ga0075471_10413259	Not Available	676	Open in IMG/M
3300006641\|Ga0075471_10430448	Not Available	660	Open in IMG/M
3300006805\|Ga0075464_10523710	Not Available	726	Open in IMG/M
3300006805\|Ga0075464_10607228	Not Available	674	Open in IMG/M
3300007548\|Ga0102877_1028319	All Organisms → Viruses → Predicted Viral	1639	Open in IMG/M
3300007559\|Ga0102828_1182579	Not Available	534	Open in IMG/M
3300007561\|Ga0102914_1093612	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	939	Open in IMG/M
3300007606\|Ga0102923_1221491	Not Available	586	Open in IMG/M
3300008111\|Ga0114344_1094636	All Organisms → Viruses → Predicted Viral	1091	Open in IMG/M
3300008261\|Ga0114336_1055146	Not Available	2034	Open in IMG/M
3300008953\|Ga0104241_1001518	All Organisms → Viruses → Predicted Viral	1795	Open in IMG/M
3300008996\|Ga0102831_1030251	All Organisms → Viruses → Predicted Viral	1837	Open in IMG/M
3300009059\|Ga0102830_1028569	All Organisms → Viruses → Predicted Viral	1728	Open in IMG/M
3300009159\|Ga0114978_10050249	All Organisms → Viruses → Predicted Viral	2883	Open in IMG/M
3300009160\|Ga0114981_10000317	All Organisms → Viruses	30900	Open in IMG/M
3300009161\|Ga0114966_10736017	Not Available	537	Open in IMG/M
3300009164\|Ga0114975_10000669	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	25624	Open in IMG/M
3300009180\|Ga0114979_10038339	All Organisms → Viruses → Predicted Viral	3025	Open in IMG/M
3300009181\|Ga0114969_10012969	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	6062	Open in IMG/M
3300009183\|Ga0114974_10002650	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13751	Open in IMG/M
3300010388\|Ga0136551_1007812	All Organisms → Viruses → Predicted Viral	2300	Open in IMG/M
3300010970\|Ga0137575_10006053	All Organisms → Viruses → Predicted Viral	2203	Open in IMG/M
3300011268\|Ga0151620_1039062	All Organisms → Viruses → Predicted Viral	1592	Open in IMG/M
3300012667\|Ga0157208_10000909	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7345	Open in IMG/M
3300013092\|Ga0163199_1016909	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3736	Open in IMG/M
3300020483\|Ga0207418_100326	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8933	Open in IMG/M
3300021519\|Ga0194048_10002161	Not Available	9756	Open in IMG/M
3300021519\|Ga0194048_10002662	Not Available	8831	Open in IMG/M
3300021602\|Ga0194060_10039802	All Organisms → Viruses → Predicted Viral	2802	Open in IMG/M
3300021962\|Ga0222713_10049632	All Organisms → Viruses → Predicted Viral	3215	Open in IMG/M
3300021963\|Ga0222712_10000205	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	86163	Open in IMG/M
3300021963\|Ga0222712_10004743	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14076	Open in IMG/M
3300021963\|Ga0222712_10064488	All Organisms → Viruses → Predicted Viral	2671	Open in IMG/M
3300022553\|Ga0212124_10135694	All Organisms → Viruses → Predicted Viral	1362	Open in IMG/M
3300023174\|Ga0214921_10056325	All Organisms → Viruses → Predicted Viral	3382	Open in IMG/M
3300023174\|Ga0214921_10106651	All Organisms → Viruses → Predicted Viral	2076	Open in IMG/M
3300023184\|Ga0214919_10000994	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	47901	Open in IMG/M
3300023184\|Ga0214919_10129413	All Organisms → Viruses → Predicted Viral	2057	Open in IMG/M
3300024346\|Ga0244775_10003330	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17094	Open in IMG/M
3300024346\|Ga0244775_10010688	Not Available	8741	Open in IMG/M
3300024346\|Ga0244775_10014706	Not Available	7289	Open in IMG/M
3300024346\|Ga0244775_10133916	All Organisms → Viruses → Predicted Viral	2096	Open in IMG/M
3300024348\|Ga0244776_10051937	All Organisms → Viruses → Predicted Viral	3196	Open in IMG/M
3300024348\|Ga0244776_10263838	All Organisms → Viruses → Predicted Viral	1192	Open in IMG/M
3300024348\|Ga0244776_10856258	Not Available	543	Open in IMG/M
3300025732\|Ga0208784_1026711	Not Available	1851	Open in IMG/M
3300027127\|Ga0255071_1021687	All Organisms → Viruses → Predicted Viral	1004	Open in IMG/M
3300027142\|Ga0255065_1001393	Not Available	5858	Open in IMG/M
3300027193\|Ga0208800_1000118	Not Available	13158	Open in IMG/M
3300027218\|Ga0208165_1005006	All Organisms → Viruses → Predicted Viral	1996	Open in IMG/M
3300027250\|Ga0208310_1011739	All Organisms → Viruses → Predicted Viral	1493	Open in IMG/M
3300027631\|Ga0208133_1045912	All Organisms → Viruses → Predicted Viral	1063	Open in IMG/M
3300027689\|Ga0209551_1193549	Not Available	625	Open in IMG/M
3300027710\|Ga0209599_10005440	All Organisms → Viruses → Predicted Viral	4428	Open in IMG/M
3300027754\|Ga0209596_1004285	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10932	Open in IMG/M
3300027754\|Ga0209596_1004730	Not Available	10299	Open in IMG/M
3300027759\|Ga0209296_1002329	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13728	Open in IMG/M
3300027763\|Ga0209088_10039735	All Organisms → Viruses → Predicted Viral	2330	Open in IMG/M
3300027797\|Ga0209107_10000099	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	52410	Open in IMG/M
3300027892\|Ga0209550_10126007	All Organisms → Viruses → Predicted Viral	1867	Open in IMG/M
3300027892\|Ga0209550_10261457	All Organisms → Viruses → Predicted Viral	1137	Open in IMG/M
3300027969\|Ga0209191_1000524	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	29376	Open in IMG/M
3300031519\|Ga0307488_10119281	All Organisms → Viruses → Predicted Viral	1893	Open in IMG/M
3300032092\|Ga0315905_10122416	All Organisms → Viruses → Predicted Viral	2610	Open in IMG/M
3300032093\|Ga0315902_10414491	All Organisms → Viruses → Predicted Viral	1211	Open in IMG/M
3300033992\|Ga0334992_0004996	Not Available	9534	Open in IMG/M
3300033992\|Ga0334992_0466594	Not Available	553	Open in IMG/M
3300034066\|Ga0335019_0081036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Eikenella → unclassified Eikenella → Eikenella sp. HMSC061C02	2190	Open in IMG/M
3300034066\|Ga0335019_0198604	All Organisms → Viruses → Predicted Viral	1299	Open in IMG/M
3300034068\|Ga0334990_0006282	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6432	Open in IMG/M
3300034082\|Ga0335020_0000786	All Organisms → Viruses	23397	Open in IMG/M
3300034102\|Ga0335029_0006417	Not Available	9239	Open in IMG/M
3300034106\|Ga0335036_0005113	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	11131	Open in IMG/M
3300034168\|Ga0335061_0020810	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3483	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.20%
Terrestrial	Environmental → Terrestrial	1.80%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	65.77%
Marine	Environmental → Aquatic → Marine	32.43%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.80%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	29.73%
Lentic	Environmental → Aquatic → Freshwater → Lentic	27.93%
Unclassified	Environmental → Aquatic → Marine → Unclassified	15.32%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	10.81%
Coastal	Environmental → Aquatic → Marine → Coastal	6.31%
Lotic	Environmental → Aquatic → Freshwater → Lotic	2.70%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	1.80%
River	Environmental → Aquatic → Freshwater → River	1.80%
Pond	Environmental → Aquatic → Freshwater → Pond	1.80%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.80%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	29.73%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	24.32%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	15.32%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	10.81%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	6.31%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	2.70%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	1.80%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	1.80%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	1.80%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.80%
Unclassified	Environmental → Aquatic → Freshwater → Pond → Unclassified	1.80%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.80%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	22.52%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	13.51%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	11.71%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	10.81%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	10.81%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	5.41%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	3.60%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	2.70%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	1.80%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	1.80%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.80%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	1.80%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.80%
Pond Fresh Water	Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water	1.80%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.80%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.90%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	0.90%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.90%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.90%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.90%
Freshwater And Marine	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine	0.90%
Sackhole Brine	Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine	0.90%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352004	Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion	Environmental	Open in IMG/M
3300000756	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011	Environmental	Open in IMG/M
3300000882	Freshwater microbial communities from the Columbia River	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300003413	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD	Environmental	Open in IMG/M
3300003430	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD	Environmental	Open in IMG/M
3300004054	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)	Environmental	Open in IMG/M
3300004112	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)	Environmental	Open in IMG/M
3300004124	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)	Environmental	Open in IMG/M
3300005069	Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005941	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300006641	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300007548	Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007561	Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3	Environmental	Open in IMG/M
3300007606	Estuarine microbial communities from the Columbia River estuary - metaG 1569-02	Environmental	Open in IMG/M
3300008111	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008953	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4	Environmental	Open in IMG/M
3300008996	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747	Environmental	Open in IMG/M
3300009059	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300010388	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015	Environmental	Open in IMG/M
3300010970	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016	Environmental	Open in IMG/M
3300011268	Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555	Environmental	Open in IMG/M
3300012667	Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15	Environmental	Open in IMG/M
3300013092	Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m	Environmental	Open in IMG/M
3300020483	Freshwater microbial communities from Lake Mendota, WI - 05AUG2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300021602	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022553	Powell_combined assembly	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300025732	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027127	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h	Environmental	Open in IMG/M
3300027142	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h	Environmental	Open in IMG/M
3300027193	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)	Environmental	Open in IMG/M
3300027218	Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes)	Environmental	Open in IMG/M
3300027250	Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 (SPAdes)	Environmental	Open in IMG/M
3300027631	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)	Environmental	Open in IMG/M
3300027689	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027797	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300031519	Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032093	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034068	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031	Environmental	Open in IMG/M
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034168	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2199948558	2199352004	Freshwater	MNRLLTTLVQLGIGIPALIMLRLVWREIVADYREWANSH
JGI12421J11937_100198152	3300000756	Freshwater And Sediment	MTTNRLLTTLVQLGIGIPALLMARLVWREIVSDYREWANSH*
FwDRAFT_100780095	3300000882	Freshwater And Marine	MNRLLTTLVQLSIAIPALYMGRMMWREMLADFREWDKSQ*
JGI25908J49247_100026327	3300003277	Freshwater Lake	MNRLLTTLVQLGIAIPALIMGRMVWREIVADYREWANSH*
JGI25922J50271_100029871	3300003413	Freshwater Lake	MNRLLTTLVQLSLALPALYMGRMMWREIVADYREWANSH*
JGI25921J50272_100014982	3300003430	Freshwater Lake	MNRLLTTLVQLAIAIPALYMGRMMWQELKQDVREVIKDFR*
JGI25921J50272_101133723	3300003430	Freshwater Lake	MNRLLTTFVQLALAIPALYMGRMMWQELKQDVREVIKDFR*
Ga0063232_101259472	3300004054	Freshwater Lake	MNRLLTSLVQLAIAIPALYMGRMMWQELKADFREMMRGN*
Ga0065166_103317051	3300004112	Freshwater Lake	MNRLLTTIVQLSIAIPALYMGRMMWREIVADFREWDKSH*
Ga0066178_101655561	3300004124	Freshwater Lake	MNRLLTTLVQLGIGIPALYMGRMVLREVIADTKEMMRGN*
Ga0071350_11198292	3300005069	Freshwater	MTTNRILTTLVQLGIGIPALYMARLMWADLKEDVREVIKDFR*
Ga0070374_100615409	3300005517	Freshwater Lake	CVMNRLLTTLVQLGIAIPALIMGRMVWREIVADYREWANSH*
Ga0070374_102523302	3300005517	Freshwater Lake	MNRLLTSLVQLAIAIPALYMGRMMWHEMKEDFRELRKGN*
Ga0070374_103113765	3300005517	Freshwater Lake	MNRLLTTLVQLALAIPALYMGRMMWREIVADFREWDRSH
Ga0049084_100454497	3300005585	Freshwater Lentic	MNRLLTTLVQLGIGIPALIMLRLVWREIVADYREWANSH*
Ga0078894_101595492	3300005662	Freshwater Lake	MNRLLTTLVQLALAIPALYMGRMMWREIVADFREWDRSH*
Ga0078894_102410085	3300005662	Freshwater Lake	MNRLLTTLVQLSLALPALYMGRMMWREIVADFREWDNSH*
Ga0078894_104296614	3300005662	Freshwater Lake	MTTNRLLTTAVQIGIGIPTLLMMRLMWREIVADFREWDKSH*
Ga0078894_104353682	3300005662	Freshwater Lake	MNRLLTTLVQLALAIPALYMGRMMWREIVADFREWDKSH*
Ga0078894_104644451	3300005662	Freshwater Lake	MNRLLTTLVQLSIALPALYMGRMMWREIVADFREWDKSH*
Ga0078894_104678955	3300005662	Freshwater Lake	MNRLLTSLVQLAIAIPALYMGRMMWREIVADFREWDKSH*
Ga0078894_105197294	3300005662	Freshwater Lake	MNRLLTTLVQLGIAIPALYMGRLMWQELKEDVREVIKDFR*
Ga0078894_106626831	3300005662	Freshwater Lake	MTTNRLLTTLVQLGIGIPALLMMRLMWREIVADFREWDKSH*
Ga0078894_107896731	3300005662	Freshwater Lake	MTTNRLLTTAVQLGIGIPALYMLRLMWREIVSDFREWDKSH*
Ga0078894_111630412	3300005662	Freshwater Lake	MNRLLTSLVQLAIAIPALYMGRLMWHELKQDVREVIKDFR*
Ga0078894_111713362	3300005662	Freshwater Lake	MNRLLTTLVQLSLALPALYMGRMMWREIVADYREWAKSH*
Ga0078894_116554383	3300005662	Freshwater Lake	MNRLLTTLVQLAIGIPALYMGRIVLQELKQDVREVIKDFR*
Ga0070743_100398244	3300005941	Estuarine	MNRLLTTAVQLAIGIPALYMARLMWLEIVADFREWDKSH*
Ga0070743_100467041	3300005941	Estuarine	MNRLITTLVQIALLVPALYMGRMMWREIVADFREWDNSH*
Ga0070743_100789036	3300005941	Estuarine	MNRLLTTFVQLALAIPALYMGRMMWREIVADFREWDRSH*
Ga0070744_100130045	3300006484	Estuarine	MSTNRILTTLVQLGIGIPALIMLRLVWREIVADFREWANSH*
Ga0070744_100282874	3300006484	Estuarine	MNRLITTLVQVALIVPALVMGRMVWREIVADYIKWGKSH*
Ga0070744_100418214	3300006484	Estuarine	MTTNRILTTLVQLGIGIPALLMARLVWREIVSDYREWANSH*
Ga0070744_101305964	3300006484	Estuarine	MTTNRILTTLVQLGIGIPALLMLRLVWREIVSDYREWANSH*
Ga0070744_102012582	3300006484	Estuarine	MNRLLTTLVQLGIGIPALLMARLVWREIVSDYREWANSH*
Ga0079301_10307136	3300006639	Deep Subsurface	MTTNRLLTTAVQLGIGIPTLLMLRLMWREIVADFREWDKSH*
Ga0075471_100727341	3300006641	Aqueous	MNRLLTTLVQLALVIPALVMGRMMWREIVADFREWDKSH*
Ga0075471_104132592	3300006641	Aqueous	MNRLLTTLVQLAIGIPALYMARLMWREIVADFREWDKSH*
Ga0075471_104304481	3300006641	Aqueous	MNRLLTTLVQLSIAIPALYMGRMMWREIVADFREWDKSH*
Ga0075464_105237104	3300006805	Aqueous	MNRLLTTLVQLGIAIPALYMGRMMWHELKADFREMMRGN*
Ga0075464_106072281	3300006805	Aqueous	MTTNRLLTTAVQLGIGIPTLLMMRLMWREIVADFREWDKSH*
Ga0102877_10283194	3300007548	Estuarine	MNRLLTSLVQVALIVPALYMGRMMWREIVADFKEWDKSH*
Ga0102828_11825793	3300007559	Estuarine	MNRLLTTLVQLGIGIPALYMGRMVLREVIADTKEMIRGN*
Ga0102914_10936124	3300007561	Estuarine	MNRLLTTAVQLAIGIPALYMARLMWREIVADFREWDKSH*
Ga0102923_12214912	3300007606	Estuarine	MNRLITSLVQVALLVPALYMGRMMWREIVADFREWD
Ga0114344_10946364	3300008111	Freshwater, Plankton	MNRLITSLVQIGIAIPALYCARLMWHELKEDVREVIKDFR*
Ga0114336_10551463	3300008261	Freshwater, Plankton	MNRLLTTLVQLAIGIPALYMGRIVWQELKQDVREVIKDFR*
Ga0104241_10015183	3300008953	Freshwater	MTTNRILTTLVQLAIGIPALYMARLMWREVLADFREWDKSH*
Ga0102831_10302511	3300008996	Estuarine	MNRLLTTFVQLALAIPALYMGRMVLREVIADAKEMWQESH*
Ga0102830_10285694	3300009059	Estuarine	MNRLLTTLVQLALAIPALYMGRMMWHELKQDVREVIK
Ga0114978_1005024913	3300009159	Freshwater Lake	LMNRLLTTLVQLALIVPALIMGRMMWREIVADYREWANSH*
Ga0114981_1000031727	3300009160	Freshwater Lake	MNRLLTTLVQLALIIPALIMGRMMWREIVANFREWANSH*
Ga0114966_107360171	3300009161	Freshwater Lake	MNRLITTLVQIALIVPALIMGRMVWREIVADYMEWDKSH*
Ga0114975_1000066934	3300009164	Freshwater Lake	MNRLLTSLVQIAIGIPALYMGRIVLREIVSDFREWSKSH*
Ga0114979_100383393	3300009180	Freshwater Lake	MNRLLTTLVQLALIVPALIMGRMMWREIVADYREWANSH*
Ga0114969_100129691	3300009181	Freshwater Lake	MTTNRILTTLVQLAIGIPALYMARLMWREIVSDFREWDKSH*
Ga0114974_1000265013	3300009183	Freshwater Lake	MNRLLTTLVQIGIGIPALYCARLMWREISNDFREWDKTQ*
Ga0136551_10078123	3300010388	Pond Fresh Water	MNRLITSLVQLALAVPALYMGRMVLREVIADAKEMWQESH*
Ga0137575_100060534	3300010970	Pond Fresh Water	MNRLLTTLVQASIAVPALYMARWVWRDIVADYREWDKSH*
Ga0151620_10390625	3300011268	Freshwater	MNRLLTTLVQLAIAIPALYMGRMMWREIVADYREWAKSH*
Ga0157208_100009096	3300012667	Freshwater	MNRLLTTLVQLALAVPALYMGRMVLREVIADAKEMWQESH*
Ga0163199_10169096	3300013092	Freshwater	MNRLLTTLVQLFLLVPALIMGRMVWREIVADYIEWDKSH*
Ga0207418_10032615	3300020483	Freshwater	MTTNRLLTTAVQIGIGIPTLLMMRLMWREIVADFREWDKSH
Ga0194048_100021613	3300021519	Anoxic Zone Freshwater	MNRLITTLVQIALLVPALYMGRMMWREIVADFREWDKSH
Ga0194048_100026625	3300021519	Anoxic Zone Freshwater	MNRLLTSLVQVALLVPALYMGRMMWREIVADFREWDKSH
Ga0194060_100398028	3300021602	Anoxic Zone Freshwater	MNRLLTTLVQLALIIPALYMGRMMWREIVADFREWDKSH
Ga0222713_1004963211	3300021962	Estuarine Water	MTTNRILTTLVQLGIGIPALLMARLVWREIVSDYREWANSH
Ga0222712_1000020511	3300021963	Estuarine Water	MNRLLTTLVQLALIVPALYMGRMMWREIVADFREWDKSH
Ga0222712_1000474322	3300021963	Estuarine Water	MNRLLTSLVQLAIAIPALYMGRMMWREIVADFREWDKSH
Ga0222712_100644889	3300021963	Estuarine Water	MTTNRILTTLVQLGIGIPALIMLRLVWREIVADFREWANSH
Ga0212124_101356946	3300022553	Freshwater	MNRLLTTLVQLFLLVPALIMGRMVWREIVADYIEWDKSH
Ga0214921_1005632511	3300023174	Freshwater	MTTNRILTTLVQLAIGIPALYMARLMWREIVADFKEWDKSH
Ga0214921_101066516	3300023174	Freshwater	MTLNRLLTSLVQIGLIVPALYMGRMMWREIVADFREWDKSH
Ga0214919_1000099437	3300023184	Freshwater	MTTNRILTTLVQIALLVPALYMARLMWREIVSDFREWDKSH
Ga0214919_101294138	3300023184	Freshwater	MTTNRILTTLVQLAIGIPALYMARLMWREIIADFKEWDKSH
Ga0244775_1000333026	3300024346	Estuarine	MNRLITTLVQIALLVPALYMGRMMWREIVADFREWDNSH
Ga0244775_1001068812	3300024346	Estuarine	MNRLLTTFVQLALAIPALYMGRMMWREIVADFREWDRSH
Ga0244775_1001470620	3300024346	Estuarine	MSTNRILTTLVQLGIGIPALIMLRLVWREIVADFREWANSH
Ga0244775_101339165	3300024346	Estuarine	MNRLLTTLVQLGIAIPALIMGRMVWREIVADYREWANSH
Ga0244776_100519374	3300024348	Estuarine	MNRLLTTAVQLAIGIPALYMARLMWREIVADFREWDKSH
Ga0244776_102638381	3300024348	Estuarine	MNRLLTILVQIAIGIPAIYMGRLMWREIVADFREWDKSH
Ga0244776_108562581	3300024348	Estuarine	ILTTLVQLGIGIPALLMARLVWREIVSDYREWANSH
Ga0208784_10267117	3300025732	Aqueous	MNRLLTTLVQLALVIPALVMGRMMWREIVADFREWDKSH
Ga0255071_10216873	3300027127	Freshwater	MNRLLTTIVQLGIAIPALYMGRMMWQELKQDLKEM
Ga0255065_100139316	3300027142	Freshwater	MNRLLTTIVQLGIAIPALYMGRMMWQELKQDLKEMMK
Ga0208800_100011836	3300027193	Estuarine	MTTNRILTTLVQLGIGIPALLMLRLVWREIVSDYREWANSH
Ga0208165_10050064	3300027218	Estuarine	MNRLLTSLVQVALIVPALYMGRMMWREIVADFKEWDKSH
Ga0208310_10117397	3300027250	Estuarine	LTTAVQLAIGIPALYMARLMWREIVADFREWDKSH
Ga0208133_10459122	3300027631	Estuarine	MNRLLTTLVQIALIVPALIMGRMVWREIVADYMEWDKSH
Ga0209551_11935493	3300027689	Freshwater Lake	MNRLLTTLVQLAIAIPALYMGRMMWQELKQDVREVIKDFR
Ga0209599_100054405	3300027710	Deep Subsurface	MTTNRLITTAVQIGIGIPTLLMMRLMWREIVADFREWDKSH
Ga0209596_10042853	3300027754	Freshwater Lake	MNRLITTLVQIALIVPALIMGRMVWREIVADYMEWDKSH
Ga0209596_100473014	3300027754	Freshwater Lake	MTTNRILTTLVQLAIGIPALYMARLMWREIVSDFREWDKSH
Ga0209296_100232913	3300027759	Freshwater Lake	MNRLLTTLVQIGIGIPALYCARLMWREISNDFREWDKTQ
Ga0209088_100397353	3300027763	Freshwater Lake	MNRLLTTLVQLALIVPALIMGRMMWREIVADYREWANSH
Ga0209107_1000009934	3300027797	Freshwater And Sediment	MTTNRLLTTLVQLGIGIPALLMARLVWREIVSDYREWANSH
Ga0209550_101260074	3300027892	Freshwater Lake	MNRLLTTIVQLSIAIPALYMVRLMWHDLKQDVREVIKDFR
Ga0209550_102614573	3300027892	Freshwater Lake	MNRLLTSLVQLAIAIPALYMGRMMWHEMKEDFRELRKGN
Ga0209191_100052438	3300027969	Freshwater Lake	MNRLLTSLVQIAIGIPALYMGRIVLREIVSDFREWSKSH
Ga0307488_101192814	3300031519	Sackhole Brine	MTTNRLLTTAVQLGIGIPALYMLRLMWREIVSDFREWDKSH
Ga0315905_101224163	3300032092	Freshwater	MNRLLTTLVQLSIAIPALYMGRMMWREIVADFREWDKSH
Ga0315902_104144911	3300032093	Freshwater	MTTNRLLTTAVQIGIGIPTLLMMRLMWREIVADFRE
Ga0334992_0004996_9282_9401	3300033992	Freshwater	MNRLLTTLVQLGIGIPALLMARLVWREILSDYRKWANSH
Ga0334992_0466594_446_553	3300033992	Freshwater	LTTLVQLGIGIPALIMLRLVWREIVADYREWANSH
Ga0335019_0081036_1510_1629	3300034066	Freshwater	MNRLLTTLVQLSIALPALYMGRMMWREIVADFREWDKSH
Ga0335019_0198604_996_1115	3300034066	Freshwater	MNRLLTSLVQLAIAIPALYMGRMMWHEMKEDFKELRKGN
Ga0334990_0006282_2899_3024	3300034068	Freshwater	MTTNRILTTLVQLGIGIPALLMARLVWREIVSDYREWAKSH
Ga0335020_0000786_9316_9447	3300034082	Freshwater	MGRVMNRLLTTLVQLGIGIPALIMLRLVWREIVADYREWANSH
Ga0335029_0006417_7820_7942	3300034102	Freshwater	MNRLLTTLVQLGIAIPALYMGRLMWQELKEDVREVIKDFR
Ga0335036_0005113_1495_1617	3300034106	Freshwater	MNRLLTTLVQLSIAIPALYMGRMMWHELKQDVREVIKDFR
Ga0335061_0020810_2155_2280	3300034168	Freshwater	MTTNRILTTLVQLAIGIPALYMARLMWREVLADFREWDKSH

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F085708

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences