Scaffold Ga0373404_0239183

Overview

Basic Information

• Taxon OID: 3300033757
• Scaffold ID: Ga0373404_0239183
• Source Dataset Name: Leachate microbial community from anaerobic digester in University of Toronto, Ontario, Canada - S62W2 SP
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 545
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Leachate → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: University of Toronto, Ontario, Canada
• Coordinates
  • Lat. (^o): 43.6629
  • Long. (^o): -79.3957

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030405	Metagenome / Metatranscriptome	185	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0373404_0239183_266_373	F030405	N/A	MQGYDDDLFILALAKTVTPGGSPRREPGQAAPLTT