Scaffold Ga0316612_1000598

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316612_1000598

Scaffold Ga0316612_1000598

Overview

Basic Information
Taxon OID	3300033494 Open in IMG/M
Scaffold ID	Ga0316612_1000598 Open in IMG/M
Source Dataset Name	Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.226
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10405
Total Scaffold Genes	24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (4.17%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	45.1993	Long. (^o)	-83.3279	Alt. (m)		Depth (m)	185
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092108	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316612_10005983	F092108	N/A	MGILRISAKCSDLCWTEYTDAKGNKTESDGYVPEGIGISSDGDCGDYVSLDIDMQTGQIQNWKPVSDARVIKAQKSA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.