Scaffold Ga0334886_1046210

Overview

Basic Information

• Taxon OID: 3300033176
• Scaffold ID: Ga0334886_1046210
• Source Dataset Name: Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_27_06-R1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1700
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands

Source Dataset Sampling Location

• Location Name: Netherlands: Wageningen, Gelderland
• Coordinates
  • Lat. (^o): 51.9691
  • Long. (^o): 5.6654

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080090	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334886_10462104	F080090	N/A	QRYEHDRHWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT