Scaffold Ga0334884_1053645

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0334884_1053645

Scaffold Ga0334884_1053645

Overview

Basic Information
Taxon OID	3300033170 Open in IMG/M
Scaffold ID	Ga0334884_1053645 Open in IMG/M
Source Dataset Name	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_12_05 R1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1626
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands

Source Dataset Sampling Location
Location Name	Netherlands: Wageningen, Gelderland
Coordinates	Lat. (^o)	51.9691	Long. (^o)	5.6654	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093892	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334884_10536454	F093892	N/A	QILSGSIMIFLFKYKANQPAEPVKIKTSPFRNLDETCSLVEEVFKREKSKEKKTYFCRTRGRIDGSI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.