NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0325391_109103

Scaffold Ga0325391_109103


Overview

Basic Information
Taxon OID3300032438 Open in IMG/M
Scaffold IDGa0325391_109103 Open in IMG/M
Source Dataset NameMetatranscriptome of lab enriched sorghum-adapted microbial communities from California, United States - WT_Day14_7 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)883
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass → Lab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.8406Long. (o)-122.2901Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073514Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0325391_1091031F073514N/AVSQRVTHARQLVAEGHSPSVVARVMQISRQAIYRTPKPRRSPQRRP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.