| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300032438 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0135754 | Gp0346124 | Ga0325391 |
| Sample Name | Metatranscriptome of lab enriched sorghum-adapted microbial communities from California, United States - WT_Day14_7 (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 35662552 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Lab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass → Lab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: California | |||||||
| Coordinates | Lat. (o) | 37.8406 | Long. (o) | -122.2901 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073514 | Metagenome / Metatranscriptome | 120 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0325391_109103 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0325391_109103 | Ga0325391_1091031 | F073514 | VSQRVTHARQLVAEGHSPSVVARVMQISRQAIYRTPKPRRSPQRRP |
| ⦗Top⦘ |