| Basic Information | |
|---|---|
| Family ID | F073514 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VSERVARSRELVARGFAAAAVARVLQITRQAIYRTPTPR |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.36 % |
| % of genes near scaffold ends (potentially truncated) | 95.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.17 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 0.00% Coil/Unstructured: 64.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF01527 | HTH_Tnp_1 | 81.67 |
| PF02371 | Transposase_20 | 4.17 |
| PF08388 | GIIM | 1.67 |
| PF13276 | HTH_21 | 1.67 |
| PF08241 | Methyltransf_11 | 0.83 |
| PF13701 | DDE_Tnp_1_4 | 0.83 |
| PF02401 | LYTB | 0.83 |
| PF02769 | AIRS_C | 0.83 |
| PF07702 | UTRA | 0.83 |
| PF07040 | DUF1326 | 0.83 |
| PF13683 | rve_3 | 0.83 |
| PF06253 | MTTB | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 4.17 |
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 1.67 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.83 |
| COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.00 % |
| Unclassified | root | N/A | 5.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908032|Perma_A_C_ConsensusfromContig54646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 2124908039|B3_v_NODE_25417_len_1351_cov_5_516654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1401 | Open in IMG/M |
| 2140918008|ConsensusfromContig126624 | Not Available | 1566 | Open in IMG/M |
| 2170459009|GA8DASG02IHPLY | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101882225 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300001526|A105W1_1094039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 992 | Open in IMG/M |
| 3300001537|A2065W1_10105642 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300002025|smpD1_1059456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10121578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1014 | Open in IMG/M |
| 3300002072|JGIcombinedJ21914_10107058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 855 | Open in IMG/M |
| 3300002184|JGI24770J26754_10052060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1786 | Open in IMG/M |
| 3300002548|JGI24974J35850_1014803 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300002551|JGI24135J36437_1032083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 855 | Open in IMG/M |
| 3300002568|C688J35102_119988163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 837 | Open in IMG/M |
| 3300003312|P12013IDBA_1076650 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300003313|P32013IDBA_1094509 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300003992|Ga0055470_10034843 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300005904|Ga0075280_10145272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300005985|Ga0081539_10376263 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005985|Ga0081539_10428373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300006578|Ga0074059_11798897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Actinotalea → Actinotalea ferrariae | 593 | Open in IMG/M |
| 3300007004|Ga0079218_11895684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
| 3300009012|Ga0066710_101120721 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300009090|Ga0099827_11594957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300009789|Ga0126307_11151210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300009789|Ga0126307_11783899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 500 | Open in IMG/M |
| 3300009809|Ga0105089_1081457 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300009840|Ga0126313_11150745 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300010045|Ga0126311_10976657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300010045|Ga0126311_11111533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 650 | Open in IMG/M |
| 3300010166|Ga0126306_11442025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 570 | Open in IMG/M |
| 3300010301|Ga0134070_10473789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 504 | Open in IMG/M |
| 3300010329|Ga0134111_10552209 | Not Available | 511 | Open in IMG/M |
| 3300010333|Ga0134080_10543444 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010361|Ga0126378_11778171 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300010376|Ga0126381_101967086 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300011244|Ga0137483_118005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 511 | Open in IMG/M |
| 3300011412|Ga0137424_1067972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 688 | Open in IMG/M |
| 3300012014|Ga0120159_1203456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300012045|Ga0136623_10394109 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012046|Ga0136634_10285034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300012187|Ga0136622_10041903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1955 | Open in IMG/M |
| 3300012188|Ga0136618_10190981 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300012189|Ga0137388_10557189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae | 1065 | Open in IMG/M |
| 3300012200|Ga0137382_10022406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 3651 | Open in IMG/M |
| 3300012201|Ga0137365_10369513 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300012201|Ga0137365_10379499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
| 3300012204|Ga0137374_10885591 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012204|Ga0137374_11117763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 559 | Open in IMG/M |
| 3300012211|Ga0137377_11047901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 746 | Open in IMG/M |
| 3300012353|Ga0137367_10853330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300012358|Ga0137368_10025317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5500 | Open in IMG/M |
| 3300012358|Ga0137368_10511278 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300012680|Ga0136612_10443946 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300012925|Ga0137419_11431038 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012951|Ga0164300_11072089 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012975|Ga0134110_10456042 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300013011|Ga0169967_1043274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 823 | Open in IMG/M |
| 3300013105|Ga0157369_11449492 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300013772|Ga0120158_10127021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1462 | Open in IMG/M |
| 3300014311|Ga0075322_1130770 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300015264|Ga0137403_10044210 | All Organisms → cellular organisms → Bacteria | 4623 | Open in IMG/M |
| 3300015374|Ga0132255_104255813 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300016341|Ga0182035_11624294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300016404|Ga0182037_11909956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 532 | Open in IMG/M |
| 3300017657|Ga0134074_1229869 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300017695|Ga0180121_10104870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1018 | Open in IMG/M |
| 3300017695|Ga0180121_10278307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas carbonis | 632 | Open in IMG/M |
| 3300017695|Ga0180121_10400454 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300018007|Ga0187805_10416130 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300018071|Ga0184618_10481440 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018481|Ga0190271_12924875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 573 | Open in IMG/M |
| 3300018482|Ga0066669_11836000 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300019356|Ga0173481_10756675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 532 | Open in IMG/M |
| 3300020074|Ga0194113_10809713 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300020186|Ga0163153_10177974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1113 | Open in IMG/M |
| 3300024430|Ga0196962_10084839 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300025314|Ga0209323_10629767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
| 3300025319|Ga0209520_10236428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1139 | Open in IMG/M |
| 3300025322|Ga0209641_10628293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300025857|Ga0209014_10211207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
| 3300025915|Ga0207693_10720334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300026297|Ga0209237_1223451 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300026538|Ga0209056_10212512 | Not Available | 1404 | Open in IMG/M |
| 3300027332|Ga0209861_1036069 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300027546|Ga0208984_1137976 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027618|Ga0208736_1062562 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300027846|Ga0209180_10549380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300027882|Ga0209590_10666998 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10054367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1615 | Open in IMG/M |
| 3300028578|Ga0272482_10170811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 654 | Open in IMG/M |
| 3300028654|Ga0265322_10232962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300028705|Ga0307276_10159578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 578 | Open in IMG/M |
| 3300028717|Ga0307298_10206587 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300028778|Ga0307288_10296105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300028819|Ga0307296_10750303 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300028884|Ga0307308_10658116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300028885|Ga0307304_10570205 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031170|Ga0307498_10218279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
| 3300031234|Ga0302325_11612835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
| 3300031470|Ga0272432_1017511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 5671 | Open in IMG/M |
| 3300031572|Ga0318515_10664372 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031680|Ga0318574_10634897 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300031731|Ga0307405_12117279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 505 | Open in IMG/M |
| 3300031747|Ga0318502_10831313 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031763|Ga0318537_10258962 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031779|Ga0318566_10445996 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300031834|Ga0315290_11475701 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031949|Ga0214473_11419203 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300031965|Ga0326597_11687907 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300032005|Ga0307411_12043932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 535 | Open in IMG/M |
| 3300032256|Ga0315271_11499006 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300032423|Ga0325352_122818 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300032438|Ga0325391_109103 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300032896|Ga0335075_11704643 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300033290|Ga0318519_10930197 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300033432|Ga0326729_1076467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.17% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 7.50% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.17% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.33% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.33% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
| Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 1.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.67% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.67% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.67% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.67% |
| Plant Biomass | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass | 1.67% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.83% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Permafrost And Active Layer Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil | 0.83% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.83% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.83% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.83% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 2124908039 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001526 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002025 | Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_D1 | Environmental | Open in IMG/M |
| 3300002071 | Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002072 | Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005) | Environmental | Open in IMG/M |
| 3300002184 | Freshwater and sediment microbial communities from Lake Erie, Canada | Environmental | Open in IMG/M |
| 3300002548 | Polar desert microbial communities from Antarctic Dry Valleys - UQ255 | Environmental | Open in IMG/M |
| 3300002551 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003312 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P1 sample | Environmental | Open in IMG/M |
| 3300003313 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P3 sample | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011244 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 18 - S13.2.60.3.a - transect 2, repeat 3, age 113 years, surface depth) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013011 | Gypsum crust endolithic microbial communities from the Atacama Desert, Chile - KM37 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
| 3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027618 | Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031470 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nord | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032423 | Metatranscriptome of lab enriched sorghum-adapted microbial communities from California, United States - SM_Day2_7 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032438 | Metatranscriptome of lab enriched sorghum-adapted microbial communities from California, United States - WT_Day14_7 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Perma_A_C_02672140 | 2124908032 | Soil | VIKEGLGVNERVTRSRELVARGFAAASVTRVLQISRQAVY |
| B3_v_00333360 | 2124908039 | Soil | VSVRVARSRRLVAEGYALATVARVLKVSRQALYRTPKPRTVPQRRP |
| Bog_all_C_04065220 | 2140918008 | Soil | VSVRVARSRDLVAAGYPLSAVARAARISRQALYRTPK |
| F47_10836170 | 2170459009 | Grass Soil | VRERVARSRELVARGFALAAVTRVLQVSRQAVYRVPAPRRPPQRRPP |
| INPhiseqgaiiFebDRAFT_1018822251 | 3300000364 | Soil | VRQRVARSRELIAEGHSPSVVARVALISRQALYRVPTPRRLPQRRPPAD |
| A105W1_10940391 | 3300001526 | Permafrost | VRERVARSRVLVARGYAVAAVARVLKVSRQAIYRTPRPR |
| A2065W1_101056421 | 3300001537 | Permafrost | VRQRVARSRELVAEGHSPSLVARVAQITRQAIYRTPKTQP |
| smpD1_10594561 | 3300002025 | Permafrost And Active Layer Soil | VSVRVARSRVLVAEGDALATVARVMQITRQALYRVPKPRNPPD |
| JGIcombinedJ21915_101215781 | 3300002071 | Arctic Peat Soil | VRVAQARVLVAQGETLAAVARVMQISRQAVYRTPRPAGAHRSAGR |
| JGIcombinedJ21914_101070581 | 3300002072 | Arctic Peat Soil | VRVAQARVLVAQGETLAAVARVMQISRQAVYRTPRP |
| JGI24770J26754_100520604 | 3300002184 | Freshwater And Sediment | VRQRVARSRDLVAAGYKPAAVARVSQISRQAIYRTPTTTPSAARRSRPP |
| JGI24974J35850_10148033 | 3300002548 | Polar Desert | MRVARSRSRELVAQGRPAAVVARVAGISRQAIYRRPKRPADGAA |
| JGI24135J36437_10320831 | 3300002551 | Arctic Peat Soil | VGVSVRVAQARVLVAQGETLAAVARVMQISRQAVYRTPRP |
| C688J35102_1199881631 | 3300002568 | Soil | MRVTRPRELVAEGYRPSAVARVAQISRQAIYRVPKPRRAPPSPSR |
| P12013IDBA_10766503 | 3300003312 | Ore Pile And Mine Drainage Contaminated Soil | VSERVARSRELVARGFPLAAVTRVLQVSRQAVYRTPKPRTA |
| P32013IDBA_10945091 | 3300003313 | Ore Pile And Mine Drainage Contaminated Soil | VSERVARSRELVARGFPLAAVTRVLQVSRQAVYRTPKPRTAPQRRRPA |
| Ga0055470_100348431 | 3300003992 | Natural And Restored Wetlands | VSERVARSRELVARGFAAATVARVLQITRQAIYRTPTPRSVPQRR |
| Ga0075280_101452721 | 3300005904 | Rice Paddy Soil | VSERVARSRELVARGFAAATVARVLQISRQAIYRTPRPRTVPQRRSPA |
| Ga0081539_103762631 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VSERVTRSRELVAQGRPAAVVARVAGISRQAIYRRPR |
| Ga0081539_104283732 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VSERVARSRELVARGFAVAAVARVLQVSRQALYRTPTPRRPPP |
| Ga0074059_117988972 | 3300006578 | Soil | VRLRVARSRELVAEGHSPSVVARVALVSRQALYRTPKPRTVPQRRPPT |
| Ga0079218_118956842 | 3300007004 | Agricultural Soil | MRVTRSRELVAEGYRPSAVARVAQISRQAIYRVPKPRRSPAAPAR |
| Ga0099791_103047583 | 3300007255 | Vadose Zone Soil | VSERVARSRELVAGGFAAAAVARVMQITRQAIYRTPTPRAVPQRRPPADAVE |
| Ga0066710_1011207213 | 3300009012 | Grasslands Soil | MRVAQSRVLVAEREAAAAVMRVMQISRQALYRTPK |
| Ga0099827_115949572 | 3300009090 | Vadose Zone Soil | VSERVARSRELVARGFAAAAVALVLQITRQAIYRTPTPRSVPQRR |
| Ga0126307_111512103 | 3300009789 | Serpentine Soil | VTQRVARSRDLVAEGHSPSVVARVAHVSRQALYRVPRPR |
| Ga0126307_117838991 | 3300009789 | Serpentine Soil | VSERVTYARELVAAGHRPAVVARILQISRQAIFRIPKPRRPLA |
| Ga0105089_10814572 | 3300009809 | Groundwater Sand | VSERVARSRVLVARGRKLAVVARVMQVSRQAIYRTP |
| Ga0126313_111507451 | 3300009840 | Serpentine Soil | VKLRVARARELVARGRRAAVVARVLQISRQAIYRTPKPRR |
| Ga0126311_109766571 | 3300010045 | Serpentine Soil | VSQRVARSRELVAEGESPSVVARVAQISRQAIYRIPKTRPPAARRSAP |
| Ga0126311_111115332 | 3300010045 | Serpentine Soil | VSERVTRSRELVAQGRPVAVVSRVAGISRQAIYRRPRRPPR |
| Ga0126306_114420252 | 3300010166 | Serpentine Soil | VSGRVTYARELAAAGHRPAVVARILQISRQAIYRVPKP |
| Ga0134070_104737892 | 3300010301 | Grasslands Soil | VSTRVTRSRELVARGFAVAAVARVLQISRQALYRTPAPRTVPQRR |
| Ga0134111_105522092 | 3300010329 | Grasslands Soil | VSERVARSRELVARGFAAAAVARVMQISRQALYRTPTARRPPQRRPVSEP |
| Ga0134080_105434442 | 3300010333 | Grasslands Soil | MRVARSRELVARGFAVAAVARVMQISRQALYRTPMPR |
| Ga0126378_117781713 | 3300010361 | Tropical Forest Soil | VSERVARSRELVDRGFKLAAVARVLQVTRQAIYRVPKPRRAPDA* |
| Ga0126381_1019670863 | 3300010376 | Tropical Forest Soil | VRERVARSRELVARGFRVAAVTRVLQVSRQAVYRTPTPRRPPQRRPA |
| Ga0137483_1180051 | 3300011244 | Glacier Forefield Soil | MRVTRSRELVAAGYRPAAVARVAQISRQAIYRKPRSRRVP |
| Ga0137393_111705321 | 3300011271 | Vadose Zone Soil | VSVRVAQARVLVAEGEVLAVVARVMQISRQAVYRRPRPRRSPQRRPVT |
| Ga0137424_10679721 | 3300011412 | Soil | MRVTRSRELVAEGYRPSAVARVAQISRQAIYRTPKPRRAPASPQKRPADRV |
| Ga0120159_12034561 | 3300012014 | Permafrost | VSVRVARSRRLVAEGYPLASVARVLQVSRQALYRTPTPRRAPQRRRPADL |
| Ga0136623_103941092 | 3300012045 | Polar Desert Sand | VRQRVARSRELVAEGHSPSVVARVALISRQAIYRTPT |
| Ga0136634_102850343 | 3300012046 | Polar Desert Sand | VRVRVARSRELVAAGFACAAVARVMQVSRQALYRVPA |
| Ga0136622_100419031 | 3300012187 | Polar Desert Sand | MRVTRSRELVAEGYRPSAVARVAQISRQAIYRIPKPR |
| Ga0136618_101909811 | 3300012188 | Polar Desert Sand | VTERVAFARELVGRGRKVAPVARVLQISRQAIYRT |
| Ga0137388_105571893 | 3300012189 | Vadose Zone Soil | VRQRVARSRELVAEGHAPSVVARVAQISRQALYRVPRPRTMPR |
| Ga0137382_100224064 | 3300012200 | Vadose Zone Soil | VSERVTRSRELVARGFAVATVARVLQISRQALYRTP |
| Ga0137365_103695132 | 3300012201 | Vadose Zone Soil | MRVARSRELVARGFAAAAVARVMQISRQALYRTPTPR |
| Ga0137365_103794992 | 3300012201 | Vadose Zone Soil | MRVARSRELVARGFAVAAVARVMQISRQALYRTPMPRGPL* |
| Ga0137374_108855912 | 3300012204 | Vadose Zone Soil | VSERVARSRELVARGFAAAAVARVMQITRQAIHRRPTPPT |
| Ga0137374_111177631 | 3300012204 | Vadose Zone Soil | VRERVARSRELVARGLAVATVARVMQISRQALYRTPTP |
| Ga0137377_110479011 | 3300012211 | Vadose Zone Soil | VSERVARSRELVARGFAAAAVARVLQITRQAIYRTPT |
| Ga0137367_108533301 | 3300012353 | Vadose Zone Soil | VRVARSRELVARGFAVAAVTRVLQVSRQAVYRTPSPRRPPQ |
| Ga0137368_100253178 | 3300012358 | Vadose Zone Soil | VRERVARSRELVARGLAVATVARVMQISRQALYRTPTPRRPP |
| Ga0137368_105112782 | 3300012358 | Vadose Zone Soil | VSERVARSRELVARGFAVAAVARVLQITRQAIYRTPTPRRVPQRRPP |
| Ga0136635_102368153 | 3300012530 | Polar Desert Sand | MQRVAFARELVGRGRKVAPVARTLQISRAAIYRTPKPRRSPQRRPPQ |
| Ga0136612_104439461 | 3300012680 | Polar Desert Sand | VSERVARSRELVARGFAAASVARVLQITRQAIYRIPTPRTVPPRRPLAD |
| Ga0137419_114310381 | 3300012925 | Vadose Zone Soil | VSERVARSRELVAGGFAATAVARVMQITRQAIYRTPTPR |
| Ga0164300_110720892 | 3300012951 | Soil | VTQRVARSRHLVAEGHSPSAVARVARISRQALYRTPR |
| Ga0134110_104560422 | 3300012975 | Grasslands Soil | VRQRVARSRELVAEGHPPSVVARVARITRQALYRTPRPRA |
| Ga0169967_10432741 | 3300013011 | Rock | MRVARSRELVAQGRPAALVARVAGISRQAIYRRPRRPPKGQ |
| Ga0157369_114494921 | 3300013105 | Corn Rhizosphere | VSVRVARSRRLVAEGYALATVARVMQVSRQAIYRTPKPRVAPQ |
| Ga0120158_101270212 | 3300013772 | Permafrost | VIKERLGVNERVTRSRELVAPGFAAATVTRVLQISR |
| Ga0075322_11307702 | 3300014311 | Natural And Restored Wetlands | VSERVARSRELVARGFAAATVARVLQITRQAIYRTP |
| Ga0137403_100442101 | 3300015264 | Vadose Zone Soil | VSERVARSRELVARGFAVAAVARVLQITRQAIYRTPT |
| Ga0132255_1042558131 | 3300015374 | Arabidopsis Rhizosphere | VRERVTRSRELVARGFAVAAVTRVLQVSRQAVYRTPTPRTVPQRRPPVDP |
| Ga0182035_116242942 | 3300016341 | Soil | VRVAQARVLVAEGEALAGVARVMQISRQAVYRRPR |
| Ga0182037_119099562 | 3300016404 | Soil | GGSIARLGVSERVARSRELVDRGHKVAVVARGLQVTRQAIYRVPRPRRAPESRS |
| Ga0134074_12298691 | 3300017657 | Grasslands Soil | VSVRVARSRELVARGFAAAAVARVMQISRQALYRTPTARRPPQRRP |
| Ga0180121_101048703 | 3300017695 | Polar Desert Sand | VRQRVARARELVDSGRKAAVVARVLQISRQAIYRTP |
| Ga0180121_102783072 | 3300017695 | Polar Desert Sand | VRERVARSRVLVARGRKPAVVARVMQITRQAIYRTPK |
| Ga0180121_104004541 | 3300017695 | Polar Desert Sand | VRVRVARSRELVARGFAAAAVARVMQVSRQALYRTPT |
| Ga0187805_104161303 | 3300018007 | Freshwater Sediment | VRERVARSRELVAKGYALAAVARVLQVTRQALYRTPKPRC |
| Ga0184618_104814402 | 3300018071 | Groundwater Sediment | VRVARSRELVAKGYALATVARVLQVTRQAIYRTPK |
| Ga0190271_129248752 | 3300018481 | Soil | MRVTRSRELVAEGHSPSAVSRVAQISRQAIYRVPTTR |
| Ga0066669_118360001 | 3300018482 | Grasslands Soil | VRRRVARSRELVARGFAVAVVVRVMQISRQTLYRTPPRRRP |
| Ga0173481_107566751 | 3300019356 | Soil | MRVTRSRELVAEGYRPSAVARVAQISRHAMYRVPKPRRAPDSASR |
| Ga0194113_108097132 | 3300020074 | Freshwater Lake | VTERVAFARDLVGRGRKVAPVARTLQITRQAIYRTPKPRRAPQ |
| Ga0163153_101779741 | 3300020186 | Freshwater Microbial Mat | VRERVARSRQLVARGRKPAVVARVMQISRQAIYRT |
| Ga0196962_100848393 | 3300024430 | Soil | MRVTRSRELVAEGYRPSAVARVAQISRQAIYRTPKP |
| Ga0209323_106297672 | 3300025314 | Soil | VSERVARSRELVAGGFAAAVVARVLQISRQAIYRTPTPRRP |
| Ga0209520_102364283 | 3300025319 | Soil | VSERVARSRELVAGGFAAAVVARVLQISRQAIYRTPTPRRPPLRR |
| Ga0209641_106282931 | 3300025322 | Soil | VSERVARSRELVAGGFAAAVVARVLQISRQAIYRTPTPRRPPL |
| Ga0209014_102112072 | 3300025857 | Arctic Peat Soil | VRVAHARVLVAEGEALAAVARVMQISRQALYRTPKP |
| Ga0207693_107203341 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VNVRVARSRELVARGFALAAVTRVLQVSRQAVYRTPTPRRPPQRRPPADP |
| Ga0209237_12234512 | 3300026297 | Grasslands Soil | VSERVARSRELVARGFAAAAVARVMQITRQAIYRVPTPRTAPQRRPVRD |
| Ga0209056_102125121 | 3300026538 | Soil | VSVRVARSRELVARGFAAAAVARVMQISRQALYRT |
| Ga0209861_10360692 | 3300027332 | Groundwater Sand | VRVRVARSRELVARGFAAAAVARVMQISRQALYRVPTPRTV |
| Ga0208984_11379762 | 3300027546 | Forest Soil | VSERVARSRELVARGFAAAAVARVLQITRQAIYRTPTPRTV |
| Ga0208736_10625621 | 3300027618 | Polar Desert | MATRVGMCVTRSRELVAEGYALAAVARVAQITRQAIYRKP |
| Ga0209180_105493802 | 3300027846 | Vadose Zone Soil | MRVARSRELVARGFAVAAVARVLQISRQALYRTPTPRTVPQRRPAV |
| Ga0209590_106669981 | 3300027882 | Vadose Zone Soil | VSERVARSRELVARGFAAAAVARVMQITRQALYRV |
| (restricted) Ga0233417_100543671 | 3300028043 | Sediment | VSERVARSRELVARGFAAATAARVLQISRQAVYRTP |
| Ga0272482_101708111 | 3300028578 | Soil | MRVTRSRELVAEGYYSPSVVARVAQISRQAIYRVPKSRPAAARRGLS |
| Ga0265322_102329621 | 3300028654 | Rhizosphere | VELSVRVARSRDLVAAGYPLSAVARAARISRQALYRTPKPRR |
| Ga0307276_101595781 | 3300028705 | Soil | MRVTRSRELVAEGYRPSVVARVAQISRQAIYRVPKPR |
| Ga0307298_102065872 | 3300028717 | Soil | VNERVARSRELVARGFAAATVTRVLQVSRQAVYRTPTPRTVPQRRPVTD |
| Ga0307288_102961051 | 3300028778 | Soil | VSQRVARSRELVAQGRPAALVARVAGISRQAIYRRPAR |
| Ga0307296_107503031 | 3300028819 | Soil | VRQRVARSRDLVAEGHSPSLVARVAQVSRQALYRT |
| Ga0307308_106581162 | 3300028884 | Soil | MRVTRSRELVAEGYRPSVVARVAQISRQAIYRVPKPRRQPASP |
| Ga0307304_105702051 | 3300028885 | Soil | VSERVARSRELVARGFAAAAVARVLQITRQAIYRTPTPR |
| Ga0307498_102182791 | 3300031170 | Soil | VSKRVARMLVAEGEALAAVARVLQISRQAVYRTPRPR |
| Ga0302325_116128351 | 3300031234 | Palsa | VRERVARSRVMAARGRKVAVVARVMQISRQAIYRTPKT |
| Ga0272432_10175117 | 3300031470 | Rock | MRVTRSRELVAEGYALSAVARVAQITRQAIYRTPKPRAAPQRRPVS |
| Ga0318515_106643722 | 3300031572 | Soil | VTKRVAYARELAAAGHRPAVVARVLQISRQAIYRVPRPRKSP |
| Ga0318574_106348971 | 3300031680 | Soil | VTKRVAYARELAAAGHRPAVVARVLQISRQAIYRVPHGLASHRT |
| Ga0307405_121172791 | 3300031731 | Rhizosphere | MRVTRSRELVAEGFRPAAVARVAQISRQAIYRTPRP |
| Ga0318502_108313132 | 3300031747 | Soil | VTKRVAYARELAAAGHRPAVVARVLQISRQAIYRVPH |
| Ga0318537_102589623 | 3300031763 | Soil | VRERVARSRQLIAKGYARASVARVMQITRQALYRTPQPRTA |
| Ga0318566_104459963 | 3300031779 | Soil | VRERVARSRQLIAKGYARASVARVMQITRQALYRTPQPR |
| Ga0315290_114757011 | 3300031834 | Sediment | VNERVTRSRELIARGFTAASVTRVLQISRQAVYRV |
| Ga0214473_114192033 | 3300031949 | Soil | VRERVARSRQLVASGRKVAIVARVMQVSRQAIYRTPKRRTDPGP |
| Ga0326597_116879072 | 3300031965 | Soil | VRQRVARSRELIAEGYRPSAVARVAKISRQALYRRPQPRAAPQRR |
| Ga0307411_120439322 | 3300032005 | Rhizosphere | VRVTRSRELVAEGFRPAAVARVAQISRQAIYRTPK |
| Ga0315271_114990061 | 3300032256 | Sediment | VSVRVVRSRELVAAGYPAATVARVALVSRQALYRVPKPRSLPQRRAP |
| Ga0325352_1228182 | 3300032423 | Plant Biomass | VSQRVTHARQLVAEGHSPSVVARVMQISRQAIYRTPKPRRSPQRRPASL |
| Ga0325391_1091031 | 3300032438 | Plant Biomass | VSQRVTHARQLVAEGHSPSVVARVMQISRQAIYRTPKPRRSPQRRP |
| Ga0335075_117046432 | 3300032896 | Soil | VTVRVARSRDLVAEGHSPSLVARVAQISRQALYRTPTPRQPPLRRPPADPI |
| Ga0318519_109301972 | 3300033290 | Soil | VTKRVAYARELAAAGHRPAVVARVLQISRQAIYRV |
| Ga0326729_10764671 | 3300033432 | Peat Soil | MRVTRSRELVAEGHSPSVVARVAQISRQAIYRIPKTRPPAARRA |
| ⦗Top⦘ |