| Basic Information | |
|---|---|
| Taxon OID | 3300031145 Open in IMG/M |
| Scaffold ID | Ga0310821_100311 Open in IMG/M |
| Source Dataset Name | Sorghum-adapted microbial communities from Joint BioEnergy Institute, Emeryville, California, United States - P4_Day56_Rep1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 27602 |
| Total Scaffold Genes | 25 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (84.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Growth Medium → Lab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Emeryville, California | |||||||
| Coordinates | Lat. (o) | 37.8406 | Long. (o) | -122.2901 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097552 | Metagenome | 104 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310821_1003111 | F097552 | N/A | EIDPLDYIDRKEILEHLEAVIDKCDDVANELQAVTAKHV |
| ⦗Top⦘ |