Metagenome Family F097552

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F097552
Family Type	Metagenome
Number of Sequences	104
Average Sequence Length	42 residues
Representative Sequence	GEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHV
Number of Associated Samples	87
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	98.08 %
% of genes from short scaffolds (< 2000 bps)	93.27 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (82.692 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (9.615 % of family members)
Environment Ontology (ENVO)	Unclassified (50.962 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (65.385 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.53
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF01384	PHO4	92.31
PF07386	DUF1499	0.96
PF03328	HpcH_HpaI	0.96
PF04784	DUF547	0.96
PF00692	dUTPase	0.96
PF12146	Hydrolase_4	0.96
PF01380	SIS	0.96
PF10609	ParA	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG0306	Phosphate/sulfate permease	Inorganic ion transport and metabolism [P]	92.31
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.96
COG0717	dCTP deaminase	Nucleotide transport and metabolism [F]	0.96
COG0756	dUTP pyrophosphatase (dUTPase)	Defense mechanisms [V]	0.96
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.96
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.96
COG4446	Uncharacterized conserved protein, DUF1499 family	Function unknown [S]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	82.69 %
Unclassified	root	N/A	17.31 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	82.69 %
Unclassified	root	N/A	17.31 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	82.69 %
Unclassified	root	N/A	17.31 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	64.42 %
Unclassified	root	N/A	17.31 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	36.54 %
Unclassified	root	N/A	17.31 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.96 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.31 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	9.62 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.88 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.92 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.96 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.31 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	9.62 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.88 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	1.92 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.96 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.31 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	9.62 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.88 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	1.92 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.96 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.31 %
unclassified Sphingomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas	9.62 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.88 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	1.92 %
Archangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae	0.96 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.31 %
Sphingomonas sp. T1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	9.62 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.88 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	1.92 %
Stigmatella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella	0.96 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.31 %
Sphingomonas sp. T1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	9.62 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.88 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	1.92 %
Stigmatella aurantiaca	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca	0.96 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.31 %
Sphingomonas sp. T1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	9.62 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.88 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	1.92 %
Stigmatella aurantiaca DW4/3-1	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1	0.96 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459020\|G1P06HT02HKEIP	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	576	Open in IMG/M
3300000559\|F14TC_100177972	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300000890\|JGI11643J12802_10141371	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300004079\|Ga0055514_10176916	All Organisms → cellular organisms → Bacteria	594	Open in IMG/M
3300004156\|Ga0062589_100216619	All Organisms → cellular organisms → Bacteria	1400	Open in IMG/M
3300004480\|Ga0062592_102382439	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300005328\|Ga0070676_10063634	All Organisms → cellular organisms → Bacteria	2198	Open in IMG/M
3300005328\|Ga0070676_11531422	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300005329\|Ga0070683_101296102	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	700	Open in IMG/M
3300005330\|Ga0070690_100484060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	923	Open in IMG/M
3300005336\|Ga0070680_101830191	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300005353\|Ga0070669_100416815	All Organisms → cellular organisms → Bacteria	1101	Open in IMG/M
3300005547\|Ga0070693_100077129	All Organisms → cellular organisms → Bacteria	1977	Open in IMG/M
3300005564\|Ga0070664_100736571	All Organisms → cellular organisms → Bacteria	920	Open in IMG/M
3300005834\|Ga0068851_10787729	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300005842\|Ga0068858_102083001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	561	Open in IMG/M
3300006237\|Ga0097621_101013512	All Organisms → cellular organisms → Bacteria	777	Open in IMG/M
3300006237\|Ga0097621_101030256	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300006358\|Ga0068871_100823513	All Organisms → cellular organisms → Bacteria	857	Open in IMG/M
3300006806\|Ga0079220_11896563	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300006914\|Ga0075436_100702312	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300007076\|Ga0075435_102008012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	508	Open in IMG/M
3300009094\|Ga0111539_11161726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	897	Open in IMG/M
3300009100\|Ga0075418_13018209	Not Available	513	Open in IMG/M
3300009177\|Ga0105248_11089434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	903	Open in IMG/M
3300009551\|Ga0105238_10627877	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1083	Open in IMG/M
3300009553\|Ga0105249_12412145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	598	Open in IMG/M
3300012206\|Ga0137380_11441463	All Organisms → cellular organisms → Bacteria → Proteobacteria	573	Open in IMG/M
3300012210\|Ga0137378_10875232	All Organisms → cellular organisms → Bacteria → Proteobacteria	811	Open in IMG/M
3300012510\|Ga0157316_1035896	All Organisms → cellular organisms → Bacteria → Proteobacteria	624	Open in IMG/M
3300012909\|Ga0157290_10439199	All Organisms → cellular organisms → Bacteria → Proteobacteria	519	Open in IMG/M
3300012951\|Ga0164300_10279606	All Organisms → cellular organisms → Bacteria → Proteobacteria	862	Open in IMG/M
3300012951\|Ga0164300_10597708	Not Available	650	Open in IMG/M
3300012955\|Ga0164298_10377163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	908	Open in IMG/M
3300012958\|Ga0164299_11134695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	587	Open in IMG/M
3300012986\|Ga0164304_11690634	All Organisms → cellular organisms → Bacteria → Proteobacteria	529	Open in IMG/M
3300012989\|Ga0164305_11264294	All Organisms → cellular organisms → Bacteria → Proteobacteria	643	Open in IMG/M
3300013100\|Ga0157373_10630764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	782	Open in IMG/M
3300013104\|Ga0157370_11956108	Not Available	526	Open in IMG/M
3300013105\|Ga0157369_12220288	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	556	Open in IMG/M
3300014497\|Ga0182008_10435172	Not Available	710	Open in IMG/M
3300015372\|Ga0132256_102357282	All Organisms → cellular organisms → Bacteria → Proteobacteria	635	Open in IMG/M
3300015372\|Ga0132256_102785671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	587	Open in IMG/M
3300015373\|Ga0132257_100799642	All Organisms → cellular organisms → Bacteria → Proteobacteria	1177	Open in IMG/M
3300015374\|Ga0132255_100434822	All Organisms → cellular organisms → Bacteria → Proteobacteria	1917	Open in IMG/M
3300015374\|Ga0132255_101354135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	1074	Open in IMG/M
3300017993\|Ga0187823_10304284	Not Available	555	Open in IMG/M
3300018076\|Ga0184609_10294105	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	760	Open in IMG/M
3300020018\|Ga0193721_1091721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	783	Open in IMG/M
3300025271\|Ga0207666_1016898	All Organisms → cellular organisms → Bacteria → Proteobacteria	1050	Open in IMG/M
3300025321\|Ga0207656_10623475	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	551	Open in IMG/M
3300025899\|Ga0207642_10196871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1110	Open in IMG/M
3300025903\|Ga0207680_10118035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1731	Open in IMG/M
3300025903\|Ga0207680_10412398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	956	Open in IMG/M
3300025903\|Ga0207680_11241425	Not Available	531	Open in IMG/M
3300025905\|Ga0207685_10458079	All Organisms → cellular organisms → Bacteria → Proteobacteria	664	Open in IMG/M
3300025907\|Ga0207645_10072005	All Organisms → cellular organisms → Bacteria → Proteobacteria	2212	Open in IMG/M
3300025907\|Ga0207645_10269368	All Organisms → cellular organisms → Bacteria → Proteobacteria	1129	Open in IMG/M
3300025909\|Ga0207705_10422047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	1033	Open in IMG/M
3300025909\|Ga0207705_11213906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	578	Open in IMG/M
3300025920\|Ga0207649_10252820	All Organisms → cellular organisms → Bacteria	1270	Open in IMG/M
3300025920\|Ga0207649_10685726	Not Available	794	Open in IMG/M
3300025921\|Ga0207652_10390266	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	1256	Open in IMG/M
3300025925\|Ga0207650_10443935	All Organisms → cellular organisms → Bacteria → Proteobacteria	1079	Open in IMG/M
3300025928\|Ga0207700_10456454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	1127	Open in IMG/M
3300025931\|Ga0207644_10687916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	852	Open in IMG/M
3300025932\|Ga0207690_11221621	All Organisms → cellular organisms → Bacteria → Proteobacteria	628	Open in IMG/M
3300025932\|Ga0207690_11477745	All Organisms → cellular organisms → Bacteria → Proteobacteria	568	Open in IMG/M
3300025934\|Ga0207686_10991784	Not Available	681	Open in IMG/M
3300025941\|Ga0207711_11621617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	590	Open in IMG/M
3300025944\|Ga0207661_11355179	Not Available	653	Open in IMG/M
3300025949\|Ga0207667_11109008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	774	Open in IMG/M
3300025961\|Ga0207712_10952043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	760	Open in IMG/M
3300025972\|Ga0207668_10052564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2819	Open in IMG/M
3300025981\|Ga0207640_11547102	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	597	Open in IMG/M
3300025981\|Ga0207640_11688068	All Organisms → cellular organisms → Bacteria → Proteobacteria	572	Open in IMG/M
3300026035\|Ga0207703_10159431	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1975	Open in IMG/M
3300026041\|Ga0207639_11570508	Not Available	617	Open in IMG/M
3300026067\|Ga0207678_10860202	Not Available	801	Open in IMG/M
3300026118\|Ga0207675_102113970	Not Available	579	Open in IMG/M
3300027462\|Ga0210000_1003229	All Organisms → cellular organisms → Bacteria	2341	Open in IMG/M
3300027897\|Ga0209254_10160535	All Organisms → cellular organisms → Bacteria → Proteobacteria	1832	Open in IMG/M
3300028379\|Ga0268266_10751021	Not Available	941	Open in IMG/M
3300028379\|Ga0268266_11326729	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	695	Open in IMG/M
3300028380\|Ga0268265_10175033	All Organisms → cellular organisms → Bacteria → Proteobacteria	1838	Open in IMG/M
3300028380\|Ga0268265_12684305	Not Available	503	Open in IMG/M
3300031145\|Ga0310821_100311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	27602	Open in IMG/M
3300031170\|Ga0307498_10477553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	506	Open in IMG/M
3300031181\|Ga0310835_121649	Not Available	686	Open in IMG/M
3300031716\|Ga0310813_11110114	All Organisms → cellular organisms → Bacteria → Proteobacteria	725	Open in IMG/M
3300031938\|Ga0308175_100139895	All Organisms → cellular organisms → Bacteria → Proteobacteria	2304	Open in IMG/M
3300031938\|Ga0308175_102223200	Not Available	615	Open in IMG/M
3300031939\|Ga0308174_10336580	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1	1200	Open in IMG/M
3300031943\|Ga0310885_10720925	All Organisms → cellular organisms → Bacteria → Proteobacteria	562	Open in IMG/M
3300031996\|Ga0308176_10105876	All Organisms → cellular organisms → Bacteria → Proteobacteria	2480	Open in IMG/M
3300032013\|Ga0310906_10442877	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	867	Open in IMG/M
3300032013\|Ga0310906_11297684	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. T1	532	Open in IMG/M
3300032074\|Ga0308173_10785159	All Organisms → cellular organisms → Bacteria → Proteobacteria	875	Open in IMG/M
3300032074\|Ga0308173_12370305	Not Available	501	Open in IMG/M
3300032770\|Ga0335085_12192972	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	555	Open in IMG/M
3300033500\|Ga0326730_1078897	All Organisms → cellular organisms → Bacteria → Proteobacteria	617	Open in IMG/M
3300033550\|Ga0247829_10585978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	926	Open in IMG/M
3300034354\|Ga0364943_0430684	Not Available	513	Open in IMG/M
3300034965\|Ga0370497_0058634	All Organisms → cellular organisms → Bacteria → Proteobacteria	864	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	55.77%
Environmental	Environmental	42.31%
Engineered	Engineered	1.92%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	55.77%
Terrestrial	Environmental → Terrestrial	38.46%
Aquatic	Environmental → Aquatic	3.85%
Solid Waste	Engineered → Solid Waste	0.96%
Lab Enrichment	Engineered → Lab Enrichment	0.96%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	36.54%
Rhizosphere	Host-Associated → Plants → Rhizosphere	35.58%
Rhizoplane	Host-Associated → Plants → Rhizoplane	16.35%
Roots	Host-Associated → Plants → Roots	2.88%
Freshwater	Environmental → Aquatic → Freshwater	1.92%
Marine	Environmental → Aquatic → Marine	0.96%
Sediment	Environmental → Aquatic → Sediment	0.96%
Peat	Environmental → Terrestrial → Peat	0.96%
Floodplain	Environmental → Terrestrial → Floodplain	0.96%
Phyllosphere	Host-Associated → Plants → Phyllosphere	0.96%
Grass	Engineered → Solid Waste → Grass	0.96%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	25.96%
Soil	Host-Associated → Plants → Rhizosphere → Soil	22.12%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	13.46%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.46%
Loam	Environmental → Terrestrial → Soil → Loam	8.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.88%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.88%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.92%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.96%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.96%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.96%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.96%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.96%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.96%
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	0.96%
Composting	Engineered → Solid Waste → Grass → Composting	0.96%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	22.12%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	13.46%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.46%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	12.50%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	9.62%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.69%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.88%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.88%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.92%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.96%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.96%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.96%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.96%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.96%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.96%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.96%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.96%
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	0.96%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.96%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	9.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	8.65%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	7.69%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.81%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.85%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.88%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	2.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.88%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.92%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.92%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.96%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.96%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.96%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.96%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.96%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.96%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.96%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.96%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.96%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.96%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.96%
Plant Biomass	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass	0.96%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.96%
Growth Medium	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Growth Medium	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459020	Litter degradation NP2	Engineered	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300004079	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012510	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610	Host-Associated	Open in IMG/M
3300012909	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017993	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3	Environmental	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300020018	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2	Environmental	Open in IMG/M
3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)	Host-Associated	Open in IMG/M
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031145	Sorghum-adapted microbial communities from Joint BioEnergy Institute, Emeryville, California, United States - P4_Day56_Rep1	Engineered	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031181	Sorghum-adapted microbial communities enriched on stacked mutant (SM) sorghum from Joint BioEnergy Institute, Emeryville, California, United States - SM_Day14_3	Host-Associated	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300033500	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300034354	Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17	Environmental	Open in IMG/M
3300034965	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2NP_02911650	2170459020	Switchgrass, Maize And Mischanthus Litter	VPWTPWATIDRKELYELIEDVVDKCDDIANSIQGITAKHV
F14TC_1001779721	3300000559	Soil	GEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHV*
JGI11643J12802_101413712	3300000890	Soil	TPIGYIDRKELYELIERVVDKCDDVANVVQTVTAKHV*
Ga0055514_101769161	3300004079	Natural And Restored Wetlands	LRAGKLDTIGYVDRKELYELVEDVVDKCDDIANTIQSITAKHV*
Ga0062589_1002166191	3300004156	Soil	RLRAQLRAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA*
Ga0062592_1023824391	3300004480	Soil	QVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA*
Ga0070676_100636344	3300005328	Miscanthus Rhizosphere	TQLRAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHV*
Ga0070676_115314222	3300005328	Miscanthus Rhizosphere	LRAQLQAGQVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA*
Ga0070683_1012961021	3300005329	Corn Rhizosphere	LRSGMVDTVAYIDRKELYEQLEDVVDKCDDIANAIQAITAKHV*
Ga0070690_1004840601	3300005330	Switchgrass Rhizosphere	LRAGEIDTIGYIDRKELFELIEDVVDKCDDVANAIQSITAKHV*
Ga0070680_1018301911	3300005336	Corn Rhizosphere	SGALAPIAYLDRKEVYELIERVVDKCDDVANVIQTVTAKHV*
Ga0070669_1004168151	3300005353	Switchgrass Rhizosphere	LRAQVTSGELDTIGYIDRKEIYELVEDVVDICDDVANAIQTITAKHV*
Ga0070693_1000771291	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	GALNAIGYIDRKELYELIERVVDKCDDVANVVQTVTAKHV*
Ga0070664_1007365712	3300005564	Corn Rhizosphere	IGYIDRKELYELIENVVDKCDDVANAIQSITAKHA*
Ga0068851_107877292	3300005834	Corn Rhizosphere	KSGEIDTLGYVDRKEIYEIVEDVVDKCDDVANAIQTITAKHV*
Ga0068858_1020830011	3300005842	Switchgrass Rhizosphere	ETIAYLDRKELYELVESVVDKCDDIANAVQSVTTKHV*
Ga0097621_1010135122	3300006237	Miscanthus Rhizosphere	SGLLALRLDLREGRVDTISYIDRKELFELIESVVDKCDDVANAVESIAAKHV*
Ga0097621_1010302561	3300006237	Miscanthus Rhizosphere	IGYIDRKELYELIENVVDKCDDVANAIQSITAKHV*
Ga0068871_1008235132	3300006358	Miscanthus Rhizosphere	DTIGYIDRKELYELVENVVDKCDDIANSIQSITAKHV*
Ga0079220_118965631	3300006806	Agricultural Soil	AQLRAGEIDTIAYIDRKELYELLEEVVDKCDDVANALQSITAKHV*
Ga0075436_1007023122	3300006914	Populus Rhizosphere	LRAGEVDTIGYIDRKELYELIENVVDKTDDVANAIQSITAKHA*
Ga0075435_1020080122	3300007076	Populus Rhizosphere	RAGEIDTIAYIDRKELYELLEEVVDKCDDVANILQSITAKHV*
Ga0111539_111617262	3300009094	Populus Rhizosphere	RSELGSGALDTIGYVDRKELYELIERVVDKCDDVANVVQTVTAKHV*
Ga0075418_130182092	3300009100	Populus Rhizosphere	LSRLRIQLRGGEIDTIAYIDRKELYELLEEVVDKCDDVANALQSVTAKHV*
Ga0105248_110894341	3300009177	Switchgrass Rhizosphere	QLKAQQVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA*
Ga0105238_106278771	3300009551	Corn Rhizosphere	THLRAQLQAGQVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA*
Ga0105249_124121452	3300009553	Switchgrass Rhizosphere	LRAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHV*
Ga0137380_114414632	3300012206	Vadose Zone Soil	AQLRRGEVDTIGYIDRKELYELIEDVVDKCDDVANAVQTITAKHA*
Ga0137378_108752321	3300012210	Vadose Zone Soil	AQLRRGEVDTIGYIDRKELYELIEDVVDKCDDVANTVQAITAKHA*
Ga0157316_10358961	3300012510	Arabidopsis Rhizosphere	ELGAGALNPIGYLDRKELYELIERVVDKCDDVANVVQTVTAKHV*
Ga0157290_104391991	3300012909	Soil	TIGYIDRKELYELIEDVVDKCDDVANAVQSIIAKHA*
Ga0164300_102796061	3300012951	Soil	PIGYLDRKELYELIERVVDKCDDVANVVQTVTAKHV*
Ga0164300_105977082	3300012951	Soil	HLRAQLRAGEVDTIRYIDLKELYELIEDVVDKCDDVANAVQSITAKHV*
Ga0164298_103771632	3300012955	Soil	RAQLRAGEIDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA*
Ga0164299_111346951	3300012958	Soil	TNLRAQLKAQQVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA*
Ga0164304_116906341	3300012986	Soil	GYLDRKELYELIERVVDKCDDVANVIQTVTAKHV*
Ga0164305_112642942	3300012989	Soil	GGGTLNVVGYIDRKELYELIERVVDKCDDVANVVQTVTAKHV*
Ga0157373_106307641	3300013100	Corn Rhizosphere	GYLDRKELYELIERVVDKCDDVANVVQTVTAKHV*
Ga0157370_119561081	3300013104	Corn Rhizosphere	LDTLGYIDRKEIYEQLEDVVDRCDDVANTVQAITAKHA*
Ga0157369_122202882	3300013105	Corn Rhizosphere	RLDTLGYIDRKEIYEQLEDVVDRCDDVANTVQAITAKHA*
Ga0182008_104351722	3300014497	Rhizosphere	GLRQGDLDTVGYLDQKELYEWIERVVDKCDDVANQIQQITAKHV*
Ga0132256_1023572822	3300015372	Arabidopsis Rhizosphere	RELGSGALAPIAYLDRKEVYELIERVVDKCDDVANVIQTVTAKHV*
Ga0132256_1027856712	3300015372	Arabidopsis Rhizosphere	GEIDTVGYIDRKELFELIENVVDKCDDVANAIQSITAKHV*
Ga0132257_1007996421	3300015373	Arabidopsis Rhizosphere	LRTGEVDTIRYIDLKELYELIEDVVDRCDDVANAVQSITAKHV*
Ga0132255_1004348221	3300015374	Arabidopsis Rhizosphere	RLRTQLRAGEIDTVGYIDRKELFELIENVVDKCDDVANAIQSITAKHV*
Ga0132255_1013541352	3300015374	Arabidopsis Rhizosphere	GYIDRKELYELIERVVDKCDDVANVVQTVTAKHV*
Ga0187823_103042842	3300017993	Freshwater Sediment	RAGEIDTLGYLDRKELLELLENVVDKCDDIANVIQSITAKHA
Ga0184609_102941052	3300018076	Groundwater Sediment	RLRAQLRAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHV
Ga0193721_10917211	3300020018	Soil	LRAQLRAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHV
Ga0207666_10168982	3300025271	Corn, Switchgrass And Miscanthus Rhizosphere	LNVVGYIDRKELYELIERVVDKCDDVANVVQTVTAKHV
Ga0207656_106234751	3300025321	Corn Rhizosphere	RAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA
Ga0207642_101968712	3300025899	Miscanthus Rhizosphere	LRAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA
Ga0207680_101180351	3300025903	Switchgrass Rhizosphere	LQAGQVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA
Ga0207680_104123982	3300025903	Switchgrass Rhizosphere	LRAQLRAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA
Ga0207680_112414252	3300025903	Switchgrass Rhizosphere	IGYIDRKEVYELIERVVDKCDDVANVVQTVTAKHV
Ga0207685_104580792	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	NAIGYIDRKELYELIERVVDKCDDVANVVQTVTAKHV
Ga0207645_100720051	3300025907	Miscanthus Rhizosphere	RLRTQLRAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHV
Ga0207645_102693681	3300025907	Miscanthus Rhizosphere	RTQLKSGEIDTLGYVDRKEIYEIVEDVVDKCDDVANAIQTITAKHV
Ga0207705_104220472	3300025909	Corn Rhizosphere	VDTIGYIDRKELYELVENVVDKCDDVANAIQTITAKHA
Ga0207705_112139061	3300025909	Corn Rhizosphere	TVGYIDRKEIYELLEDGVDKCDDISNAVQAITAKHV
Ga0207649_102528201	3300025920	Corn Rhizosphere	QPIGYLDQKELFEWIERVVDKCDDVANQIQTITAKHV
Ga0207649_106857262	3300025920	Corn Rhizosphere	PIGYLDRKELYELIERVVDKCDDVANVVQTVTAKHV
Ga0207652_103902661	3300025921	Corn Rhizosphere	GRLQPIGYLDQKELFEWIERVVDKCDDVANQIQTITAKHV
Ga0207650_104439351	3300025925	Switchgrass Rhizosphere	VTRVRAQLRAGEIDLIDYIDQKELYELIENVVDKCDDVANAIQAITAKHV
Ga0207700_104564541	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	DPIGYLDQKELFEWIERVVDKCDDVANQIQTITAKHV
Ga0207644_106879162	3300025931	Switchgrass Rhizosphere	ALRADLREGRLDTLGYIDRKEIYEQLEDVVDRCDDVANTVQAITAKHA
Ga0207690_112216211	3300025932	Corn Rhizosphere	LDTIGYLDQKELYEWIERVVDKCDDVANQIQTITAKHV
Ga0207690_114777451	3300025932	Corn Rhizosphere	AGRLQPIGYLDQKELFEWIERVVDKCDDVANQIQTITAKHV
Ga0207686_109917842	3300025934	Miscanthus Rhizosphere	IGYIDRKEIYELIEDVVDICDDVANAIQTITAKHV
Ga0207711_116216172	3300025941	Switchgrass Rhizosphere	VDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA
Ga0207661_113551792	3300025944	Corn Rhizosphere	LRSGMVDTVAYIDRKELYEQLEDVVDKCDDIANAIQAITAKHV
Ga0207667_111090081	3300025949	Corn Rhizosphere	LRAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHV
Ga0207712_109520432	3300025961	Switchgrass Rhizosphere	QVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA
Ga0207668_100525645	3300025972	Switchgrass Rhizosphere	DAIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA
Ga0207640_115471022	3300025981	Corn Rhizosphere	IGYLDRKELYEWIERVVDKCDDVANQLQTITAKHV
Ga0207640_116880682	3300025981	Corn Rhizosphere	GELDTIGYIDRKEIYELIEDVVDICDDVANAIQTITAKHV
Ga0207703_101594313	3300026035	Switchgrass Rhizosphere	AGELDTIGYIDRKELYELVENVVDKCDDIANSIQSITAKHV
Ga0207639_115705082	3300026041	Corn Rhizosphere	LTALRTELRDGRLDTLGYIDRKEIYEQLEDAVDRCDDVANTVQAITAKHA
Ga0207678_108602022	3300026067	Corn Rhizosphere	EIDTIAYLDRKELYELIENVVDKCDDIANAVQAITTKHV
Ga0207675_1021139701	3300026118	Switchgrass Rhizosphere	EVDTIRYIDLKELYELVEDVVDRCDDVANAIQSITAKHV
Ga0210000_10032294	3300027462	Arabidopsis Thaliana Rhizosphere	SELGSGVLTPIGYIDRKELYELIERVVDKCDDVANVVQTVTAKHV
Ga0209254_101605353	3300027897	Freshwater Lake Sediment	IDTIGYVDRKELYELVENVVDKCDDIANAVQTITAKHV
Ga0268266_107510212	3300028379	Switchgrass Rhizosphere	GAVDTIGYLDRKELYELIENVVDKCDDVSNAIQSITAKHV
Ga0268266_113267291	3300028379	Switchgrass Rhizosphere	RAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHV
Ga0268265_101750333	3300028380	Switchgrass Rhizosphere	VTSGELDTIGYIDRKEIYELVEDVVDICDDVANAIQTITAKHV
Ga0268265_126843051	3300028380	Switchgrass Rhizosphere	IGYLDRKELYELIERVVDKCDDVANVVQTVTAKHV
Ga0310821_1003111	3300031145	Growth Medium	EIDPLDYIDRKEILEHLEAVIDKCDDVANELQAVTAKHV
Ga0307498_104775531	3300031170	Soil	LRAQLRAGKVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA
Ga0310835_1216491	3300031181	Plant Biomass	ADVCFDQALTRLRARARAGEIDPLDYIDRKEILEHLEAVIDKCDDVANELQAVTAKHV
Ga0310813_111101141	3300031716	Soil	NVVGYIDRKELYELIERVVDKCDDVANVVQTVTAKHV
Ga0308175_1001398951	3300031938	Soil	IRSELREGRLDAIGYLDQKELYEWIERVVDKCDDVANQLQTITAKHV
Ga0308175_1022232001	3300031938	Soil	RSELREGQLDAIGYLDQKELYEWIERVVDKCDDVANQLQTITAKHV
Ga0308174_103365802	3300031939	Soil	VAYIDRKELYEQLEDVVDKCDDIANSIQAITAKHV
Ga0310885_107209251	3300031943	Soil	LNPIGYLDRKELYELIERVVDKCDDVANVVQTVTAKHV
Ga0308176_101058761	3300031996	Soil	GQLDAIGYLDQKELYEWIERVVDKCDDVANQLQTITAKHV
Ga0310906_104428771	3300032013	Soil	RAGEIDTIGYIDRKELYELLEHVVDKCDDIANAVQSITTKHV
Ga0310906_112976841	3300032013	Soil	IAYIDRKELYEHIENVVDKCDDVANAIQSITAKHA
Ga0308173_107851592	3300032074	Soil	GEVDTIAYLDRKELYELVENVVDKCDDIANAIQSITAKHV
Ga0308173_123703052	3300032074	Soil	RLRAQVRMGEIDLIGYIDQKELYELTEHVVDKCDDVANAVQAITAKHV
Ga0335085_121929721	3300032770	Soil	VDTIGYIDRKELFELIEDVVDKCDDVANAVESITAKHV
Ga0326730_10788972	3300033500	Peat Soil	IGYIDRKELYELIEGVVDKCDDVANTVQAITAKHA
Ga0247829_105859782	3300033550	Soil	LVDDALDTIGYVDRKELYELIERVVDKCDDVANVVQTVTAKHV
Ga0364943_0430684_3_131	3300034354	Sediment	RAGEVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHG
Ga0370497_0058634_3_152	3300034965	Untreated Peat Soil	TQLRAQLREGKVDTIGYIDRKELYELIENVVDKCDDVANAIQSITAKHA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F097552

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences