NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134843_1004813

Scaffold Ga0134843_1004813


Overview

Basic Information
Taxon OID3300029775 Open in IMG/M
Scaffold IDGa0134843_1004813 Open in IMG/M
Source Dataset NameLiquor fermentation pit mud microbial communities from Luzhou, China - Meta-4-1-220-B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChongqing University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6035
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location
Location NameChina: Luzhou
CoordinatesLat. (o)28.88Long. (o)105.45Alt. (m)Depth (m).01
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074840Metagenome / Metatranscriptome119N
F090569Metagenome / Metatranscriptome108Y
F103495Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0134843_100481310F103495GGAMDNLLQFLIDSGILYMIVSTLLTVGIGFIVGKGVSFKEIQDIIGAIEESYEDGYISPDEARKIYKEIEDVIGQDWYIRLFRLFKR
Ga0134843_10048132F074840AGTAGGMLELNENELAQLNQFIARHERCFDDNKYELTIHLHIIGTGIGCVHKAECENCGECIDLTDYGCW
Ga0134843_10048138F090569AGGMDYKVCGVFDAEKSKVENVYFNLVDNDKFVTLELVDENGNHVICSNICNIDKQSGKIDTCCNVNSYLGFILDSYGRVTIN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.