Basic Information | |
---|---|
Taxon OID | 3300029672 Open in IMG/M |
Scaffold ID | Ga0243361_108928 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from liver cirrhosis patients in Hangzhou, China - LD-47_Run3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Zhejiang University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1996 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Hangzhou | |||||||
Coordinates | Lat. (o) | 30.0 | Long. (o) | 120.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051936 | Metagenome | 143 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0243361_1089281 | F051936 | N/A | MKQEGTGQVLFFLLAPRGKAFGFSGLSETAVMTPVIINFSL |
⦗Top⦘ |