Scaffold Ga0243510_100051

Overview

Basic Information

• Taxon OID: 3300029397
• Scaffold ID: Ga0243510_100051
• Source Dataset Name: Anode biofilm microbial communities from acetate-fed MFC - AM-anode biofilm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Tokyo University of Pharmacy and Life Sciences
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 133354
• Total Scaffold Genes: 105
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 66 (62.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Industrial Production → Engineered Product → Bioanode → Unclassified → Anode Biofilm → Electrode-Associated Soil And Biofilms Microbial Communities From Mfcs In Japan

Source Dataset Sampling Location

• Location Name: Japan: Tokyo
• Coordinates
  • Lat. (^o): 35.638
  • Long. (^o): 139.3817

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064893	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0243510_10005133	F064893	AGGAG	MPKIVRWEFLGSWLLFWVLCITVIGIPLAILYLLNGTVRIEHEVSDPERFVTEFRSGRLTRK