| Basic Information | |
|---|---|
| Taxon OID | 3300028326 Open in IMG/M |
| Scaffold ID | Ga0268263_1000766 Open in IMG/M |
| Source Dataset Name | Microbial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 5 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 38424 |
| Total Scaffold Genes | 32 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (65.62%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lawrence Berkeley National Laboratory, California, USA | |||||||
| Coordinates | Lat. (o) | 37.8754404 | Long. (o) | -122.2477251 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078103 | Metagenome / Metatranscriptome | 116 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0268263_100076612 | F078103 | N/A | MKVEGIKVLSLVMSIAMVAVIVLSLAGGVGLGYAIIFGILNAFDRSRQLIKAAPTQVLTNSASSR |
| ⦗Top⦘ |