Scaffold Ga0302338_1055192

Overview

Basic Information

• Taxon OID: 3300028237
• Scaffold ID: Ga0302338_1055192
• Source Dataset Name: Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Reed Canary Grass, Gen10, Rep 2, Chloramphenicol (External Submission)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 783
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.4149
  • Long. (^o): -119.841
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098130	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302338_10551921	F098130	N/A	MPDPHPRRRLGGDDPFERRHVRDWAPPGWHWEVLPSGARNLVRNRGLVVDPELLWWQSRGPLAVQREPAPEEVVRRRVREEDEHVRRYMVALDDRFSNTWQFLQGSHPSYVPVMVPSLWVMTARGSGTGRRRPV