Scaffold Ga0265296_1000028

Overview

Basic Information

• Taxon OID: 3300028032
• Scaffold ID: Ga0265296_1000028
• Source Dataset Name: Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 344084
• Total Scaffold Genes: 332
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 283 (85.24%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location

• Location Name: Canada: Waterloo, Ontario
• Coordinates
  • Lat. (^o): 43.442
  • Long. (^o): -80.577

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053932	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265296_1000028214	F053932	AGG	MNRWLPYVLFPRPGWYILHAIIITLVFCLGYVVKF