Scaffold Ga0224573_1000928

Overview

Basic Information

• Taxon OID: 3300028019
• Scaffold ID: Ga0224573_1000928
• Source Dataset Name: Spruce roots microbial communities from Bohemian Forest, Czech Republic ? CRU1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2696
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.043
  • Long. (^o): 13.6183

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098130	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224573_10009283	F098130	N/A	MEHRNVRDWAPPGWHWEVLPSGARSLVRNPGPVVDPELVWWPARGPRPVQREPAPLEVVRRRIREEDEHVRRYLVALEVMTYRSWQYLPGPSAIFDPQPVPYLWVFTTRGPGPRPHH