| Basic Information | |
|---|---|
| Taxon OID | 3300027664 Open in IMG/M |
| Scaffold ID | Ga0207873_1106596 Open in IMG/M |
| Source Dataset Name | Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - BGW Initial Compost (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 886 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Comparative Metagneomics Of Mesophilic And Thermophilic Cellulose-Adapted Consortia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Berkeley, CA | |||||||
| Coordinates | Lat. (o) | 37.86971 | Long. (o) | -122.31414 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049584 | Metagenome / Metatranscriptome | 146 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207873_11065963 | F049584 | N/A | MHQIGIVGLSYRHASTDEVARFSIPKADVPARLPELREALGVSELIYL |
| ⦗Top⦘ |